NMR structure of CIP75 UBA domain
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.9 % (523 of 602) | 95.9 % (302 of 315) | 72.1 % (163 of 226) | 95.1 % (58 of 61) |
Backbone | 80.9 % (254 of 314) | 96.4 % (106 of 110) | 65.4 % (100 of 153) | 94.1 % (48 of 51) |
Sidechain | 94.3 % (316 of 335) | 95.6 % (196 of 205) | 91.7 % (110 of 120) | 100.0 % (10 of 10) |
Aromatic | 50.0 % (10 of 20) | 100.0 % (10 of 10) | 0.0 % (0 of 10) | |
Methyl | 100.0 % (64 of 64) | 100.0 % (32 of 32) | 100.0 % (32 of 32) |
1. CIP75 UBA
GPLGSMPEVR FQQQLEQLNS MGFINREANL QALIATGGDI NAAIERLLGS QLSSolvent system 93% H2O/7% D2O, Pressure 1 atm, pH 5.8, Details pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CIP75 UBA | [U-13C; U-15N] | 1.5-2.0 mM | |
2 | D2O | natural abundance | 7 % | |
3 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, pH 5.8, Details pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CIP75 UBA | [U-13C; U-15N] | 1.5-2.0 mM | |
2 | D2O | natural abundance | 7 % | |
3 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, pH 5.8, Details pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CIP75 UBA | [U-13C; U-15N] | 1.5-2.0 mM | |
2 | D2O | natural abundance | 7 % | |
3 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, pH 5.8, Details pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CIP75 UBA | [U-13C; U-15N] | 1.5-2.0 mM | |
2 | D2O | natural abundance | 7 % | |
3 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, pH 5.8, Details pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CIP75 UBA | [U-13C; U-15N] | 1.5-2.0 mM | |
2 | D2O | natural abundance | 7 % | |
3 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, pH 5.8, Details pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CIP75 UBA | [U-13C; U-15N] | 1.5-2.0 mM | |
2 | D2O | natural abundance | 7 % | |
3 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, pH 5.8, Details pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CIP75 UBA | [U-13C; U-15N] | 1.5-2.0 mM | |
2 | D2O | natural abundance | 7 % | |
3 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, pH 5.8, Details pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CIP75 UBA | [U-13C; U-15N] | 1.5-2.0 mM | |
2 | D2O | natural abundance | 7 % | |
3 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, pH 5.8, Details pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CIP75 UBA | [U-13C; U-15N] | 1.5-2.0 mM | |
2 | D2O | natural abundance | 7 % | |
3 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, pH 5.8, Details pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CIP75 UBA | [U-13C; U-15N] | 1.5-2.0 mM | |
2 | D2O | natural abundance | 7 % | |
3 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, pH 5.8, Details pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CIP75 UBA | [U-13C; U-15N] | 1.5-2.0 mM | |
2 | D2O | natural abundance | 7 % | |
3 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, pH 5.8, Details pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CIP75 UBA | [U-13C; U-15N] | 1.5-2.0 mM | |
2 | D2O | natural abundance | 7 % | |
3 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, pH 5.8, Details pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CIP75 UBA | [U-13C; U-15N] | 1.5-2.0 mM | |
2 | D2O | natural abundance | 7 % | |
3 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, pH 5.8, Details pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CIP75 UBA | [U-13C; U-15N] | 1.5-2.0 mM | |
2 | D2O | natural abundance | 7 % | |
3 | H2O | natural abundance | 93 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, pH 5.8, Details pH 5.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CIP75 UBA | [U-13C; U-15N] | 1.5-2.0 mM | |
2 | D2O | natural abundance | 7 % | |
3 | H2O | natural abundance | 93 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_16484_2knz.nef |
Input source #2: Coordindates | 2knz.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--- GPLGSMPEVRFQQQLEQLNSMGFINREANLQALIATGGDINAAIERLLGSQLS ||||||||||||||||||||||||||||||||||||||||||||||||||||| GPLGSMPEVRFQQQLEQLNSMGFINREANLQALIATGGDINAAIERLLGSQLS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 53 | 0 | 0 | 100.0 |
Content subtype: combined_16484_2knz.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--- GPLGSMPEVRFQQQLEQLNSMGFINREANLQALIATGGDINAAIERLLGSQLS ||||||||||||||||||||||||||||||||||||||||||||||||||||| GPLGSMPEVRFQQQLEQLNSMGFINREANLQALIATGGDINAAIERLLGSQLS
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
26 | ARG | HH11 | 7.56 |
36 | THR | HG1 | 3.85 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 315 | 309 | 98.1 |
13C chemical shifts | 226 | 162 | 71.7 |
15N chemical shifts | 64 | 58 | 90.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 110 | 108 | 98.2 |
13C chemical shifts | 106 | 52 | 49.1 |
15N chemical shifts | 51 | 48 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 205 | 201 | 98.0 |
13C chemical shifts | 120 | 110 | 91.7 |
15N chemical shifts | 13 | 10 | 76.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 34 | 100.0 |
13C chemical shifts | 34 | 34 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 10 | 10 | 100.0 |
13C chemical shifts | 10 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--- GPLGSMPEVRFQQQLEQLNSMGFINREANLQALIATGGDINAAIERLLGSQLS ||||||||||||||||||||||||||||||||||||||||||||||||||||| GPLGSMPEVRFQQQLEQLNSMGFINREANLQALIATGGDINAAIERLLGSQLS