Solution structure of an arsenate reductase (ArsC) related protein from Brucella melitensis. Seattle Structural Genomics Center for Infectious Disease (SSGCID) target BrabA.00007.a.
GPGSMSVTIY GIKNCDTMKK ARIWLEDHGI DYTFHDYKKE GLDAETLDRF LKTVPWEQLL NRAGTTFRKL PEDVRSNVDA ASARELMLAQ PSMVKRPVLE RDGKLMVGFK PAQYEAYFKL
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.3 % (1311 of 1436) | 88.4 % (665 of 752) | 94.0 % (528 of 562) | 96.7 % (118 of 122) |
Backbone | 95.3 % (675 of 708) | 94.2 % (228 of 242) | 95.5 % (336 of 352) | 97.4 % (111 of 114) |
Sidechain | 89.0 % (748 of 840) | 85.7 % (437 of 510) | 94.4 % (304 of 322) | 87.5 % (7 of 8) |
Aromatic | 90.2 % (110 of 122) | 90.2 % (55 of 61) | 89.8 % (53 of 59) | 100.0 % (2 of 2) |
Methyl | 93.5 % (116 of 124) | 93.5 % (58 of 62) | 93.5 % (58 of 62) |
1. BR7
GPGSMSVTIY GIKNCDTMKK ARIWLEDHGI DYTFHDYKKE GLDAETLDRF LKTVPWEQLL NRAGTTFRKL PEDVRSNVDA ASARELMLAQ PSMVKRPVLE RDGKLMVGFK PAQYEAYFKLSolvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 293 (±0.5) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BR7 | natural abundance | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±3.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1.0 atm, Temperature 293 (±0.5) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | BR7 | natural abundance | 1.0 (±0.2) mM | |
8 | sodium chloride | natural abundance | 100 (±3.0) mM | |
9 | TRIS | natural abundance | 20 (±1.0) mM | |
10 | DTT | natural abundance | 1 (±0.2) mM | |
11 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 293 (±0.5) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BR7 | natural abundance | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±3.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 293 (±0.5) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BR7 | natural abundance | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±3.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 293 (±0.5) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BR7 | natural abundance | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±3.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 293 (±0.5) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BR7 | natural abundance | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±3.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 293 (±0.5) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BR7 | natural abundance | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±3.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 293 (±0.5) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BR7 | natural abundance | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±3.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 293 (±0.5) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BR7 | natural abundance | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±3.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 293 (±0.5) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BR7 | natural abundance | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±3.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 293 (±0.5) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BR7 | natural abundance | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±3.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.0 atm, Temperature 293 (±0.5) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | BR7 | natural abundance | 1.0 (±0.2) mM | |
8 | sodium chloride | natural abundance | 100 (±3.0) mM | |
9 | TRIS | natural abundance | 20 (±1.0) mM | |
10 | DTT | natural abundance | 1 (±0.2) mM | |
11 | D2O | natural abundance | 100 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 293 (±0.5) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BR7 | natural abundance | 1.5 (±0.2) mM | |
2 | sodium chloride | natural abundance | 100 (±3.0) mM | |
3 | TRIS | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 1 (±0.2) mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16517_2kok.nef |
Input source #2: Coordindates | 2kok.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GPGSMSVTIYGIKNCDTMKKARIWLEDHGIDYTFHDYKKEGLDAETLDRFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDAASARELMLAQPSMVKRPVLE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPGSMSVTIYGIKNCDTMKKARIWLEDHGIDYTFHDYKKEGLDAETLDRFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDAASARELMLAQPSMVKRPVLE -------110-------120 RDGKLMVGFKPAQYEAYFKL |||||||||||||||||||| RDGKLMVGFKPAQYEAYFKL
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 120 | 0 | 0 | 100.0 |
Content subtype: combined_16517_2kok.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GPGSMSVTIYGIKNCDTMKKARIWLEDHGIDYTFHDYKKEGLDAETLDRFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDAASARELMLAQPSMVKRPVLE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PGSMSVTIYGIKNCDTMKKARIWLEDHGIDYTFHDYKKEGLDAETLDRFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDAASARELMLAQPSMVKRPVLE -------110-------120 RDGKLMVGFKPAQYEAYFKL |||||||||||||||||||| RDGKLMVGFKPAQYEAYFKL
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 752 | 652 | 86.7 |
13C chemical shifts | 562 | 519 | 92.3 |
15N chemical shifts | 130 | 118 | 90.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 242 | 227 | 93.8 |
13C chemical shifts | 240 | 220 | 91.7 |
15N chemical shifts | 114 | 111 | 97.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 510 | 425 | 83.3 |
13C chemical shifts | 322 | 299 | 92.9 |
15N chemical shifts | 16 | 7 | 43.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 67 | 60 | 89.6 |
13C chemical shifts | 67 | 60 | 89.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 55 | 90.2 |
13C chemical shifts | 59 | 53 | 89.8 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GPGSMSVTIYGIKNCDTMKKARIWLEDHGIDYTFHDYKKEGLDAETLDRFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDAASARELMLAQPSMVKRPVLE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....MSVTIYGIKNCDTMKKARIWLEDHGIDYTFHDYKKEGLDAETLDRFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDAASARELMLAQPSMVKRPVLE -------110-------120 RDGKLMVGFKPAQYEAYFKL |||||||| ||||||||||| RDGKLMVG.KPAQYEAYFKL
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GPGSMSVTIYGIKNCDTMKKARIWLEDHGIDYTFHDYKKEGLDAETLDRFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDAASARELMLAQPSMVKRPVLE ||||| |||||||||||| | | | | |||||||||| || || ||||||||||||| || |||| ......VTIYG.....TMKKARIWLEDH.I..T.H.Y.....DAETLDRFLK.VP..QL...................DAASARELMLAQP..VK.PVLE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120 RDGKLMVGFKPAQYEAYFKL | | ||||||||| .....M.G.KPAQYEAYF -------110--------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GPGSMSVTIYGIKNCDTMKKARIWLEDHGIDYTFHDYKKEGLDAETLDRFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDAASARELMLAQPSMVKRPVLE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||| ..GSMSVTIYGIKNCDTMKKARIWLEDHGIDYTFHDYKKEGLDAETLDRFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDAASARELMLAQ.SMVKRPVLE -------110-------120 RDGKLMVGFKPAQYEAYFKL |||||||||||||||||||| RDGKLMVGFKPAQYEAYFKL