Solution structure of humar Par-3b PDZ2 (residues 451-549)
MRGSHHHHHH HHGSENLYFQ GSYNTKKIGK RLNIQLKKGT EGLGFSITSR DVTIGGSAPI YVKNILPRGA AIQDGRLKAG DRLIEVNGVD LVGKSQEEVV SLLRSTKMEG TVSLLVFRQE D
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 73.4 % (1023 of 1394) | 69.1 % (502 of 727) | 77.5 % (417 of 538) | 80.6 % (104 of 129) |
Backbone | 80.9 % (584 of 722) | 78.4 % (200 of 255) | 82.8 % (288 of 348) | 80.7 % (96 of 119) |
Sidechain | 67.6 % (526 of 778) | 64.0 % (302 of 472) | 73.0 % (216 of 296) | 80.0 % (8 of 10) |
Aromatic | 32.6 % (28 of 86) | 41.9 % (18 of 43) | 23.3 % (10 of 43) | |
Methyl | 85.3 % (116 of 136) | 82.4 % (56 of 68) | 88.2 % (60 of 68) |
1. hPar-3 PDZ2
MRGSHHHHHH HHGSENLYFQ GSYNTKKIGK RLNIQLKKGT EGLGFSITSR DVTIGGSAPI YVKNILPRGA AIQDGRLKAG DRLIEVNGVD LVGKSQEEVV SLLRSTKMEG TVSLLVFRQE DSolvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM hPar3 PDZ2 (451-549) U-15N/13C, 20 mM sodium phosphate, 50 mM sodium chloride
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPar-3 PDZ2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | sodium azide | natural abundance | 0.02 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance III - 500 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM hPar3 PDZ2 (451-549) U-15N/13C, 20 mM sodium phosphate, 50 mM sodium chloride
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPar-3 PDZ2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance III - 500 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM hPar3 PDZ2 (451-549) U-15N/13C, 20 mM sodium phosphate, 50 mM sodium chloride
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPar-3 PDZ2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance III - 500 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM hPar3 PDZ2 (451-549) U-15N/13C, 20 mM sodium phosphate, 50 mM sodium chloride
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPar-3 PDZ2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance III - 500 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM hPar3 PDZ2 (451-549) U-15N/13C, 20 mM sodium phosphate, 50 mM sodium chloride
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPar-3 PDZ2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance III - 500 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM hPar3 PDZ2 (451-549) U-15N/13C, 20 mM sodium phosphate, 50 mM sodium chloride
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPar-3 PDZ2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance III - 500 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM hPar3 PDZ2 (451-549) U-15N/13C, 20 mM sodium phosphate, 50 mM sodium chloride
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPar-3 PDZ2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance III - 500 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM hPar3 PDZ2 (451-549) U-15N/13C, 20 mM sodium phosphate, 50 mM sodium chloride
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hPar-3 PDZ2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | sodium azide | natural abundance | 0.02 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16520_2kom.nef |
Input source #2: Coordindates | 2kom.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-430-----440-------450-------460-------470-------480-------490-------500-------510-------520-------5 MRGSHHHHHHHHGSENLYFQGSYNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRGSHHHHHHHHGSENLYFQGSYNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 30-------540--------- SLLRSTKMEGTVSLLVFRQED ||||||||||||||||||||| SLLRSTKMEGTVSLLVFRQED -------110-------120-
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 121 | 0 | 0 | 100.0 |
Content subtype: combined_16520_2kom.nef
Assigned chemical shifts
-430-----440-------450-------460-------470-------480-------490-------500-------510-------520-------5 MRGSHHHHHHHHGSENLYFQGSYNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVV | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......................Y..KKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVV 30-------540--------- SLLRSTKMEGTVSLLVFRQED ||||||||||||||||||||| SLLRSTKMEGTVSLLVFRQED
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 727 | 496 | 68.2 |
13C chemical shifts | 538 | 393 | 73.0 |
15N chemical shifts | 137 | 99 | 72.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 255 | 195 | 76.5 |
13C chemical shifts | 242 | 187 | 77.3 |
15N chemical shifts | 119 | 90 | 75.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 472 | 301 | 63.8 |
13C chemical shifts | 296 | 206 | 69.6 |
15N chemical shifts | 18 | 9 | 50.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 70 | 60 | 85.7 |
13C chemical shifts | 70 | 60 | 85.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 43 | 18 | 41.9 |
13C chemical shifts | 43 | 10 | 23.3 |
Distance restraints
-430-----440-------450-------460-------470-------480-------490-------500-------510-------520-------5 MRGSHHHHHHHHGSENLYFQGSYNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVV || |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .........................KK.GKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVV 30-------540--------- SLLRSTKMEGTVSLLVFRQED ||||||||||||||||||||| SLLRSTKMEGTVSLLVFRQED
Dihedral angle restraints
-430-----440-------450-------460-------470-------480-------490-------500-------510-------520-------5 MRGSHHHHHHHHGSENLYFQGSYNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVV ||||||||||||| ||||||| |||||||| |||||| |||||||||| ||||||| .........................KKIGKRLNIQLKK.....GFSITSR........PIYVKNIL..GAAIQD......DRLIEVNGVD...KSQEEVV -430-----440-------450-------460-------470-------480-------490-------500-------510-------520-------5 30-------540--------- SLLRSTKMEGTVSLLVFRQED |||||||||||||||||||| SLLRSTKMEGTVSLLVFRQE 30-------540--------