BMRBj - BMREntryMaster

Found 1 Document (0.709 seconds)

BMRB: 16526

2KOQ

NMR solution structures of 3-hydroxyoctanoyl-ACP from Streptomyces coelicolor Fatty Acid Synthase

Authors

Ploskon, E., Arthur, C.J., Kanari, A.J., Crump, M.P.

Assembly

Modified Fatty Acid Synthase Acyl Carrier Protein

Entity

1. ACP (polymer, Thiol state: not present), 81 monomers, 8785.706 Da Detail

AATQEEIVAG LAEIVNEIAG IPVEDVKLDK SFTDDLDVDS LSMVEVVVAA EERFDVKIPD DDVKNLKTVG DATKYILDHQ A

2. 5-HYDROXYLAEVULINIC ACID (non-polymer), 118.131 Da

Total weight

8903.837 Da

Max. entity weight

8785.706 Da

Entity Connection

covalent 1 Detail

ID	Type	Value order	Atom ID 1	Atom ID 2
1	covalent	sing	1:SER40:OG	2:SHO1:P24

Source organism

Streptomyces coelicolor

Exptl. method

solution NMR

Refine. method

simulated annealing

Data set

assigned_chemical_shifts

Chem. Shift Complete

Sequence coverage: 100.0 %, Completeness: 87.0 %, Completeness (bb): 82.4 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	87.0 % (777 of 893)	97.4 % (442 of 454)	71.1 % (253 of 356)	98.8 % (82 of 83)
Backbone	82.4 % (397 of 482)	98.2 % (160 of 163)	66.3 % (159 of 240)	98.7 % (78 of 79)
Sidechain	93.7 % (458 of 489)	96.9 % (282 of 291)	88.7 % (172 of 194)	100.0 % (4 of 4)
Aromatic	43.8 % (14 of 32)	87.5 % (14 of 16)	0.0 % (0 of 16)
Methyl	99.2 % (121 of 122)	98.4 % (60 of 61)	100.0 % (61 of 61)

1. ACP

AATQEEIVAG LAEIVNEIAG IPVEDVKLDK SFTDDLDVDS LSMVEVVVAA EERFDVKIPD DDVKNLKTVG DATKYILDHQ A

Show sample condition

Sample #1

Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
1	potassium phosphate	natural abundance	10 mM
2	sodium azide	natural abundance	0.5 mM
3	3-hydroxyoctanoyl phosphopantetheine	natural abundance	1 mM
4	ACP	[U-99% 13C; U-99% 15N]	1 mM
5	H2O	natural abundance	95 %
6	D2O	natural abundance	5 %

Sample #2

Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
7	potassium phosphate	natural abundance	10 mM
8	sodium azide	natural abundance	0.5 mM
9	3-hydroxyoctanoyl phosphopantetheine	natural abundance	1 mM
10	ACP	[U-99% 13C; U-99% 15N]	1 mM
11	H2O	natural abundance	95 %
12	D2O	natural abundance	5 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Value	Ref. method	Ref. type	Shift ratio
¹³C	water	protons	4.78 ppm	internal	indirect	0.2514495
¹H	water	protons	4.78 ppm	internal	direct	1.0
¹⁵N	water	protons	4.78 ppm	internal	indirect	0.1013291

Referencing offset: -0.23 ppm, Outliers: 4 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Value	Ref. method	Ref. type	Shift ratio
¹³C	water	protons	4.78 ppm	internal	indirect	0.2514495
¹H	water	protons	4.78 ppm	internal	direct	1.0
¹⁵N	water	protons	4.78 ppm	internal	indirect	0.1013291

Referencing offset: -0.23 ppm, Outliers: 4 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Value	Ref. method	Ref. type	Shift ratio
¹³C	water	protons	4.78 ppm	internal	indirect	0.2514495
¹H	water	protons	4.78 ppm	internal	direct	1.0
¹⁵N	water	protons	4.78 ppm	internal	indirect	0.1013291

Referencing offset: 0.03 ppm, Outliers: 1 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2KOQ, Strand ID: A Detail

Release date

2010-09-02

Citation

Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis
Ploskon, E., Arthur, C.J., Kanari, A., Wattana-amorn, P., Williams, C., Crosby, J., Simpson, T.J., Willis, C.L., Crump, M.P.
Chem. Biol. (2010), 17, 776-785, PubMed 20659690 , DOI 10.1016/j.chembiol.2010.05.024 , Abstract

Related entities 1. ACP, : 1 : 5 : 197 entities Detail

Experiments performed 4 experiments Detail

NMR combined restraints 3 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints	combined_16526_2koq.nef
Input source #2: Coordindates	2koq.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	True (see coodinates for details)
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

Ptnr_site_1	Ptnr_site_2	Redox_state_prediction_1	Redox_state_prediction_2	Distance (Å)
1:40:SER:OG	2:1:SHW:P24	unknown	unknown	n/a

Non-standard residues

Chain_ID	Seq_ID	Comp_ID	Chem_comp_name	Experimental evidences
B	1	SHW	S-[2-[3-[[(2S)-2-hydroxy-3,3-dimethyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3R)-3-hydroxyoctanethioate	None
B	40	SHO	5-HYDROXYLAEVULINIC ACID	Assigned chemical shifts

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50--------60--------70--------80-
AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	81	0	0	100.0

Content subtype: combined_16526_2koq.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Covalent bonds	assembly	OK	1		No information
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	810		100.0 (chain: A, length: 81), 50.0 (chain: B, length: 2)
1	Distance restraints	CNS/XPLOR_distance_constraints_2	OK	4958 (1)	noe	100.0 (chain: A, length: 81)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 81, Sequence coverage: 100.0%
  - Entity_assembly_ID: B, Chain length: 2, Sequence coverage: 50.0%
- Total number of assignments
  - ¹H chemical shifts: 480
  - ¹³C chemical shifts: 248
  - ¹⁵N chemical shifts: 82
- Completeness of assignments
  - Entity_assemble_ID: A
  - Entity_assemble_ID: B
- Peptide bond of PRO
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
68	THR	HG1	5.38

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	454	446	98.2
¹³C chemical shifts	356	248	69.7
¹⁵N chemical shifts	84	82	97.6

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	163	162	99.4
¹³C chemical shifts	162	76	46.9
¹⁵N chemical shifts	79	78	98.7

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	291	284	97.6
¹³C chemical shifts	194	172	88.7
¹⁵N chemical shifts	5	4	80.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	62	62	100.0
¹³C chemical shifts	62	62	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	16	14	87.5
¹³C chemical shifts	16	0	0.0

Comp_index_ID	Comp_ID
1	SHW
40	SHO

Covalent bonds

Saveframe: assembly
- Status: OK

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_2
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 81, Sequence coverage: 100.0%
- Total number of restraints: 4955
- Weight of restraints: 1.0 (4955)
- Potential type of restraints: square-well-parabolic (4955)
- Range of distance target values: 1.75, 4.0 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
  - Chain_ID: B
    None
- Distance restraints on contact map

Keywords acyl carrier protein, fatty acid synthase, intermediate binding

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.709 seconds)

BMRB: 16526

Sample #1

Sample #2

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. ACP, : 1 : 5 : 197 entities Detail

Experiments performed 4 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 3 contents Detail