Solution NMR Structure of uncharacterized protein from gene locus NE0665 of Nitrosomonas europaea. Northeast Structural Genomics Target NeR103A
MDQKSSSPQP AAQAPETKQA FPRKFVLAAL EQSSDDAGWA NLGNFGNYLN KLQPDFDSRL YGYKKLSDLV KARTDLFVTE ERQVPGSTQK ALYLRAKLEH HHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.0 % (1046 of 1245) | 82.5 % (539 of 653) | 85.2 % (409 of 480) | 87.5 % (98 of 112) |
Backbone | 86.7 % (536 of 618) | 86.6 % (181 of 209) | 86.1 % (267 of 310) | 88.9 % (88 of 99) |
Sidechain | 82.0 % (596 of 727) | 80.6 % (358 of 444) | 84.4 % (228 of 270) | 76.9 % (10 of 13) |
Aromatic | 79.7 % (94 of 118) | 79.7 % (47 of 59) | 79.3 % (46 of 58) | 100.0 % (1 of 1) |
Methyl | 97.9 % (92 of 94) | 95.7 % (45 of 47) | 100.0 % (47 of 47) |
1. protein from gene locus NE0665
MDQKSSSPQP AAQAPETKQA FPRKFVLAAL EQSSDDAGWA NLGNFGNYLN KLQPDFDSRL YGYKKLSDLV KARTDLFVTE ERQVPGSTQK ALYLRAKLEH HHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-13C,15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.957 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | Calcium Chloride | natural abundance | 5 mM | |
7 | DSS | natural abundance | 50 uM | |
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5%13C,100%15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | entity | [U-5% 13C; U-100% 15N] | 0.9 mM | |
11 | sodium chloride | natural abundance | 200 mM | |
12 | MES | natural abundance | 20 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | Calcium Chloride | natural abundance | 5 mM | |
16 | DSS | natural abundance | 50 uM | |
17 | D2O | natural abundance | 10 % | |
18 | H2O | natural abundance | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz 1.7 mm Microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-13C,15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.957 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | Calcium Chloride | natural abundance | 5 mM | |
7 | DSS | natural abundance | 50 uM | |
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz 1.7 mm Microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-13C,15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.957 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | Calcium Chloride | natural abundance | 5 mM | |
7 | DSS | natural abundance | 50 uM | |
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz 1.7 mm Microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-13C,15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.957 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | Calcium Chloride | natural abundance | 5 mM | |
7 | DSS | natural abundance | 50 uM | |
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz 1.7 mm Microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-13C,15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.957 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | Calcium Chloride | natural abundance | 5 mM | |
7 | DSS | natural abundance | 50 uM | |
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz 1.7 mm Microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-13C,15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.957 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | Calcium Chloride | natural abundance | 5 mM | |
7 | DSS | natural abundance | 50 uM | |
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz 5mm cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-13C,15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.957 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | Calcium Chloride | natural abundance | 5 mM | |
7 | DSS | natural abundance | 50 uM | |
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz 1.7 mm Microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-13C,15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.957 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | Calcium Chloride | natural abundance | 5 mM | |
7 | DSS | natural abundance | 50 uM | |
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz 1.7 mm Microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-13C,15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.957 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | Calcium Chloride | natural abundance | 5 mM | |
7 | DSS | natural abundance | 50 uM | |
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz 1.7 mm Microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-13C,15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.957 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | Calcium Chloride | natural abundance | 5 mM | |
7 | DSS | natural abundance | 50 uM | |
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz 5mm cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-13C,15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.957 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | Calcium Chloride | natural abundance | 5 mM | |
7 | DSS | natural abundance | 50 uM | |
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz 5mm cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-13C,15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.957 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | Calcium Chloride | natural abundance | 5 mM | |
7 | DSS | natural abundance | 50 uM | |
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz 1.7 mm Microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-13C,15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.957 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | Calcium Chloride | natural abundance | 5 mM | |
7 | DSS | natural abundance | 50 uM | |
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz 1.7 mm Microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-13C,15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.957 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | Calcium Chloride | natural abundance | 5 mM | |
7 | DSS | natural abundance | 50 uM | |
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz 1.7 mm Microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5%13C,100%15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | entity | [U-5% 13C; U-100% 15N] | 0.9 mM | |
11 | sodium chloride | natural abundance | 200 mM | |
12 | MES | natural abundance | 20 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | Calcium Chloride | natural abundance | 5 mM | |
16 | DSS | natural abundance | 50 uM | |
17 | D2O | natural abundance | 10 % | |
18 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz 1.7 mm Microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5%13C,100%15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | entity | [U-5% 13C; U-100% 15N] | 0.9 mM | |
11 | sodium chloride | natural abundance | 200 mM | |
12 | MES | natural abundance | 20 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | Calcium Chloride | natural abundance | 5 mM | |
16 | DSS | natural abundance | 50 uM | |
17 | D2O | natural abundance | 10 % | |
18 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz 1.7 mm Microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5%13C,100%15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | entity | [U-5% 13C; U-100% 15N] | 0.9 mM | |
11 | sodium chloride | natural abundance | 200 mM | |
12 | MES | natural abundance | 20 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | Calcium Chloride | natural abundance | 5 mM | |
16 | DSS | natural abundance | 50 uM | |
17 | D2O | natural abundance | 10 % | |
18 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz 5mm cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 5%13C,100%15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | entity | [U-5% 13C; U-100% 15N] | 0.9 mM | |
11 | sodium chloride | natural abundance | 200 mM | |
12 | MES | natural abundance | 20 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | Calcium Chloride | natural abundance | 5 mM | |
16 | DSS | natural abundance | 50 uM | |
17 | D2O | natural abundance | 10 % | |
18 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz 1.7 mm Microcryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-13C,15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.957 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | Calcium Chloride | natural abundance | 5 mM | |
7 | DSS | natural abundance | 50 uM | |
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz 5mm cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-13C,15N
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.957 mM | |
2 | sodium chloride | natural abundance | 200 mM | |
3 | MES | natural abundance | 20 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | Calcium Chloride | natural abundance | 5 mM | |
7 | DSS | natural abundance | 50 uM | |
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16560_2kpm.nef |
Input source #2: Coordindates | 2kpm.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MDQKSSSPQPAAQAPETKQAFPRKFVLAALEQSSDDAGWANLGNFGNYLNKLQPDFDSRLYGYKKLSDLVKARTDLFVTEERQVPGSTQKALYLRAKLEH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MDQKSSSPQPAAQAPETKQAFPRKFVLAALEQSSDDAGWANLGNFGNYLNKLQPDFDSRLYGYKKLSDLVKARTDLFVTEERQVPGSTQKALYLRAKLEH ----- HHHHH ||||| HHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 105 | 0 | 0 | 100.0 |
Content subtype: combined_16560_2kpm.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MDQKSSSPQPAAQAPETKQAFPRKFVLAALEQSSDDAGWANLGNFGNYLNKLQPDFDSRLYGYKKLSDLVKARTDLFVTEERQVPGSTQKALYLRAKLEH | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....S...QPAAQAPETKQAFPRKFVLAALEQSSDDAGWANLGNFGNYLNKLQPDFDSRLYGYKKLSDLVKARTDLFVTEERQVPGSTQKALYLRAKLE --------10--------20--------30--------40--------50--------60--------70--------80--------90--------- ----- HHHHH
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 653 | 538 | 82.4 |
15N chemical shifts | 117 | 98 | 83.8 |
13C chemical shifts | 480 | 405 | 84.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 209 | 181 | 86.6 |
15N chemical shifts | 99 | 87 | 87.9 |
13C chemical shifts | 210 | 179 | 85.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 444 | 357 | 80.4 |
15N chemical shifts | 18 | 11 | 61.1 |
13C chemical shifts | 270 | 226 | 83.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 48 | 47 | 97.9 |
13C chemical shifts | 48 | 47 | 97.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 59 | 47 | 79.7 |
15N chemical shifts | 1 | 1 | 100.0 |
13C chemical shifts | 58 | 46 | 79.3 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MDQKSSSPQPAAQAPETKQAFPRKFVLAALEQSSDDAGWANLGNFGNYLNKLQPDFDSRLYGYKKLSDLVKARTDLFVTEERQVPGSTQKALYLRAKLEH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .........PAAQAPETKQAFPRKFVLAALEQSSDDAGWANLGNFGNYLNKLQPDFDSRLYGYKKLSDLVKARTDLFVTEERQVPGSTQKALYLRAKLE --------10--------20--------30--------40--------50--------60--------70--------80--------90--------- ----- HHHHH
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MDQKSSSPQPAAQAPETKQAFPRKFVLAALEQSSDDAGWANLGNFGNYLNKLQPDFDSRLYGYKKLSDLVKARTDLFVTEERQVPGSTQKALYLRAKLEH |||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .........PAAQAP.TKQAFPRKFVLAALEQSSDDAGWANLGNFGNYLNKLQPDFDSRLYGYKKLSDLVKARTDLFVTEERQVPGSTQKALYLRAKLE --------10--------20--------30--------40--------50--------60--------70--------80--------90--------- ----- HHHHH