NMR solution structure of Lamin-B1 protein from Home sapiens: Northeast Structural Genomics Consortium target, HR5546A(438-548)
MGHHHHHHSH MTGNVCIEEI DVDGKFIRLK NTSEQDQPMG GWEMIRKIGD TSVSYKYTSR YVLKAGQTVT IWAANAGVTA SPPTDLIWKN QNSWGTGEDV KVILKNSQGE EVAQRSTVFK TT
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.9 % (1215 of 1398) | 93.6 % (676 of 722) | 75.0 % (406 of 541) | 98.5 % (133 of 135) |
Backbone | 82.2 % (597 of 726) | 95.2 % (240 of 252) | 67.6 % (240 of 355) | 98.3 % (117 of 119) |
Sidechain | 93.0 % (728 of 783) | 93.0 % (437 of 470) | 92.6 % (275 of 297) | 100.0 % (16 of 16) |
Aromatic | 74.2 % (89 of 120) | 75.0 % (45 of 60) | 71.4 % (40 of 56) | 100.0 % (4 of 4) |
Methyl | 100.0 % (124 of 124) | 100.0 % (62 of 62) | 100.0 % (62 of 62) |
1. Lamin-B1 protein
MGHHHHHHSH MTGNVCIEEI DVDGKFIRLK NTSEQDQPMG GWEMIRKIGD TSVSYKYTSR YVLKAGQTVT IWAANAGVTA SPPTDLIWKN QNSWGTGEDV KVILKNSQGE EVAQRSTVFK TTSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lamin-B1 protein | [U-100% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
2 | NH4OAc | natural abundance | 20 mM | |
3 | DTT | natural abundance | 100 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | CaCl2 | natural abundance | 5 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Lamin-B1 protein | [U-5% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
7 | NH4OAc | natural abundance | 20 mM | |
8 | DTT | natural abundance | 100 mM | |
9 | NaCl | natural abundance | 200 mM | |
10 | CaCl2 | natural abundance | 5 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Varian INOVA - 600 MHz Equipped with a cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lamin-B1 protein | [U-100% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
2 | NH4OAc | natural abundance | 20 mM | |
3 | DTT | natural abundance | 100 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | CaCl2 | natural abundance | 5 mM |
Varian INOVA - 600 MHz Equipped with a cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lamin-B1 protein | [U-100% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
2 | NH4OAc | natural abundance | 20 mM | |
3 | DTT | natural abundance | 100 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | CaCl2 | natural abundance | 5 mM |
Varian INOVA - 600 MHz Equipped with a cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lamin-B1 protein | [U-100% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
2 | NH4OAc | natural abundance | 20 mM | |
3 | DTT | natural abundance | 100 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | CaCl2 | natural abundance | 5 mM |
Varian INOVA - 600 MHz Equipped with a cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lamin-B1 protein | [U-100% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
2 | NH4OAc | natural abundance | 20 mM | |
3 | DTT | natural abundance | 100 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | CaCl2 | natural abundance | 5 mM |
Varian INOVA - 600 MHz Equipped with a cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lamin-B1 protein | [U-100% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
2 | NH4OAc | natural abundance | 20 mM | |
3 | DTT | natural abundance | 100 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | CaCl2 | natural abundance | 5 mM |
Varian INOVA - 600 MHz Equipped with a cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lamin-B1 protein | [U-100% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
2 | NH4OAc | natural abundance | 20 mM | |
3 | DTT | natural abundance | 100 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | CaCl2 | natural abundance | 5 mM |
Varian INOVA - 600 MHz Equipped with a cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lamin-B1 protein | [U-100% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
2 | NH4OAc | natural abundance | 20 mM | |
3 | DTT | natural abundance | 100 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | CaCl2 | natural abundance | 5 mM |
Bruker Avance - 800 MHz Equipped with a cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lamin-B1 protein | [U-100% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
2 | NH4OAc | natural abundance | 20 mM | |
3 | DTT | natural abundance | 100 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | CaCl2 | natural abundance | 5 mM |
Bruker Avance - 800 MHz Equipped with a cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lamin-B1 protein | [U-100% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
2 | NH4OAc | natural abundance | 20 mM | |
3 | DTT | natural abundance | 100 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | CaCl2 | natural abundance | 5 mM |
Bruker Avance - 800 MHz Equipped with a cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lamin-B1 protein | [U-100% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
2 | NH4OAc | natural abundance | 20 mM | |
3 | DTT | natural abundance | 100 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | CaCl2 | natural abundance | 5 mM |
Varian INOVA - 600 MHz Equipped with a cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Lamin-B1 protein | [U-5% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
7 | NH4OAc | natural abundance | 20 mM | |
8 | DTT | natural abundance | 100 mM | |
9 | NaCl | natural abundance | 200 mM | |
10 | CaCl2 | natural abundance | 5 mM |
Varian INOVA - 600 MHz Equipped with a cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Lamin-B1 protein | [U-5% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
7 | NH4OAc | natural abundance | 20 mM | |
8 | DTT | natural abundance | 100 mM | |
9 | NaCl | natural abundance | 200 mM | |
10 | CaCl2 | natural abundance | 5 mM |
Varian INOVA - 600 MHz Equipped with a cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Lamin-B1 protein | [U-5% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
7 | NH4OAc | natural abundance | 20 mM | |
8 | DTT | natural abundance | 100 mM | |
9 | NaCl | natural abundance | 200 mM | |
10 | CaCl2 | natural abundance | 5 mM |
Varian INOVA - 600 MHz Equipped with a cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lamin-B1 protein | [U-100% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
2 | NH4OAc | natural abundance | 20 mM | |
3 | DTT | natural abundance | 100 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | CaCl2 | natural abundance | 5 mM |
Varian INOVA - 600 MHz Equipped with a cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lamin-B1 protein | [U-100% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
2 | NH4OAc | natural abundance | 20 mM | |
3 | DTT | natural abundance | 100 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | CaCl2 | natural abundance | 5 mM |
Bruker Avance - 800 MHz Equipped with a cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Lamin-B1 protein | [U-5% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
7 | NH4OAc | natural abundance | 20 mM | |
8 | DTT | natural abundance | 100 mM | |
9 | NaCl | natural abundance | 200 mM | |
10 | CaCl2 | natural abundance | 5 mM |
Varian INOVA - 600 MHz Equipped with a cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Lamin-B1 protein | [U-5% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
7 | NH4OAc | natural abundance | 20 mM | |
8 | DTT | natural abundance | 100 mM | |
9 | NaCl | natural abundance | 200 mM | |
10 | CaCl2 | natural abundance | 5 mM |
Varian INOVA - 600 MHz Equipped with a cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lamin-B1 protein | [U-100% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
2 | NH4OAc | natural abundance | 20 mM | |
3 | DTT | natural abundance | 100 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | CaCl2 | natural abundance | 5 mM |
Varian INOVA - 600 MHz Equipped with a cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 1.219mM Protein, 20mM NH4OAc, 200 mM NaCl, 5mM CaCl2, 10 mM DTT, 50 uM DSS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Lamin-B1 protein | [U-100% 13C; U-100% 15N] | 1.219 (±0.2) mM | |
2 | NH4OAc | natural abundance | 20 mM | |
3 | DTT | natural abundance | 100 mM | |
4 | NaCl | natural abundance | 200 mM | |
5 | CaCl2 | natural abundance | 5 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_16572_2kpw.nef |
Input source #2: Coordindates | 2kpw.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMTGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGHHHHHHSHMTGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDV -------110-------120-- KVILKNSQGEEVAQRSTVFKTT |||||||||||||||||||||| KVILKNSQGEEVAQRSTVFKTT
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 122 | 0 | 0 | 100.0 |
Content subtype: combined_16572_2kpw.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMTGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..HHHHHHSHMTGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDV -------110-------120-- KVILKNSQGEEVAQRSTVFKTT |||||||||||||||||||||| KVILKNSQGEEVAQRSTVFKTT
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 722 | 694 | 96.1 |
13C chemical shifts | 541 | 398 | 73.6 |
15N chemical shifts | 139 | 134 | 96.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 252 | 247 | 98.0 |
13C chemical shifts | 244 | 120 | 49.2 |
15N chemical shifts | 119 | 117 | 98.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 470 | 447 | 95.1 |
13C chemical shifts | 297 | 278 | 93.6 |
15N chemical shifts | 20 | 17 | 85.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 66 | 65 | 98.5 |
13C chemical shifts | 66 | 65 | 98.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 60 | 45 | 75.0 |
13C chemical shifts | 56 | 40 | 71.4 |
15N chemical shifts | 4 | 4 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMTGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......HHSHMTGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDV -------110-------120-- KVILKNSQGEEVAQRSTVFKTT |||||||||||||||||||||| KVILKNSQGEEVAQRSTVFKTT