Solution Structure Of Protein BH0266 From Bacillus halodurans. Northeast Structural Genomics Consortium Target BhR97a
MPTFDHGNLS LGELELTVLY DEERYDIVEQ TETVQVDLEG PRGVLTVFRF ARPSYEVFVD LTEAGEGSHT VDVEHRGFPG DLAVTVEPRM ARVQLEERQT VSVPVTVEMI NLEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 80.7 % (1093 of 1354) | 87.5 % (607 of 694) | 69.7 % (377 of 541) | 91.6 % (109 of 119) |
Backbone | 78.9 % (554 of 702) | 91.3 % (219 of 240) | 66.2 % (231 of 349) | 92.0 % (104 of 113) |
Sidechain | 84.0 % (641 of 763) | 85.5 % (388 of 454) | 81.8 % (248 of 303) | 83.3 % (5 of 6) |
Aromatic | 45.5 % (50 of 110) | 58.2 % (32 of 55) | 32.7 % (18 of 55) | |
Methyl | 98.6 % (146 of 148) | 97.3 % (72 of 74) | 100.0 % (74 of 74) |
1. BH0266
MPTFDHGNLS LGELELTVLY DEERYDIVEQ TETVQVDLEG PRGVLTVFRF ARPSYEVFVD LTEAGEGSHT VDVEHRGFPG DLAVTVEPRM ARVQLEERQT VSVPVTVEMI NLEHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-5% 13C; U-99% 15N] | 1.0 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-5% 13C; U-99% 15N] | 1.0 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16576_2kq1.nef |
Input source #2: Coordindates | 2kq1.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MPTFDHGNLSLGELELTVLYDEERYDIVEQTETVQVDLEGPRGVLTVFRFARPSYEVFVDLTEAGEGSHTVDVEHRGFPGDLAVTVEPRMARVQLEERQT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MPTFDHGNLSLGELELTVLYDEERYDIVEQTETVQVDLEGPRGVLTVFRFARPSYEVFVDLTEAGEGSHTVDVEHRGFPGDLAVTVEPRMARVQLEERQT -------110--------- VSVPVTVEMINLEHHHHHH ||||||||||||||||||| VSVPVTVEMINLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 119 | 0 | 0 | 100.0 |
Content subtype: combined_16576_2kq1.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MPTFDHGNLSLGELELTVLYDEERYDIVEQTETVQVDLEGPRGVLTVFRFARPSYEVFVDLTEAGEGSHTVDVEHRGFPGDLAVTVEPRMARVQLEERQT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..TFDHGNLSLGELELTVLYDEERYDIVEQTETVQVDLEGPRGVLTVFRFARPSYEVFVDLTEAGEGSHTVDVEHRGFPGDLAVTVEPRMARVQLEERQT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110--------- VSVPVTVEMINLEHHHHHH |||||||||||| VSVPVTVEMINL -------110--
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 694 | 613 | 88.3 |
13C chemical shifts | 541 | 358 | 66.2 |
15N chemical shifts | 127 | 113 | 89.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 240 | 222 | 92.5 |
13C chemical shifts | 238 | 110 | 46.2 |
15N chemical shifts | 113 | 104 | 92.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 454 | 391 | 86.1 |
13C chemical shifts | 303 | 248 | 81.8 |
15N chemical shifts | 14 | 9 | 64.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 77 | 75 | 97.4 |
13C chemical shifts | 77 | 75 | 97.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 55 | 32 | 58.2 |
13C chemical shifts | 55 | 18 | 32.7 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MPTFDHGNLSLGELELTVLYDEERYDIVEQTETVQVDLEGPRGVLTVFRFARPSYEVFVDLTEAGEGSHTVDVEHRGFPGDLAVTVEPRMARVQLEERQT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..TFDHGNLSLGELELTVLYDEERYDIVEQTETVQVDLEGPRGVLTVFRFARPSYEVFVDLTEAGEGSHTVDVEHRGFPGDLAVTVEPRMARVQLEERQT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110--------- VSVPVTVEMINLEHHHHHH |||||||||||| VSVPVTVEMINL -------110--
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MPTFDHGNLSLGELELTVLYDEERYDIVEQTETVQVDLEGPRGVLTVFRFARPSYEVFVDLTEAGEGSHTVDVEHRGFPGDLAVTVEPRMARVQLEERQT ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..TFDHGNLSLGELELTVLYDEERYDIVEQTETVQVDLEGPRGVLTVFRFARPSYEVFVDLTEAGEGSHTVDVEHRGFPGDLAVTVEPRMARVQLEE --------10--------20--------30--------40--------50--------60--------70--------80--------90------- -------110--------- VSVPVTVEMINLEHHHHHH