Solution structure of SNase140
ATSTKKLHKE PATLIKAIDG DTVKLMYKGQ PMTFRLLLVD TPETKHPKKG VEKYGPEASA FTKKMVENAK KIEVEFDKGQ RTDKYGRGLA YIYADGKMVN EALVRQGLAK VAYVYKPNNT HEQLLRKSEA QAKKEKLNIW
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.5 % (1558 of 1702) | 93.2 % (837 of 898) | 88.8 % (585 of 659) | 93.8 % (136 of 145) |
Backbone | 97.8 % (810 of 828) | 98.6 % (279 of 283) | 97.8 % (402 of 411) | 96.3 % (129 of 134) |
Sidechain | 87.3 % (877 of 1005) | 90.7 % (558 of 615) | 82.3 % (312 of 379) | 63.6 % (7 of 11) |
Aromatic | 49.1 % (54 of 110) | 90.9 % (50 of 55) | 5.6 % (3 of 54) | 100.0 % (1 of 1) |
Methyl | 96.7 % (145 of 150) | 100.0 % (75 of 75) | 93.3 % (70 of 75) |
1. SNase140
ATSTKKLHKE PATLIKAIDG DTVKLMYKGQ PMTFRLLLVD TPETKHPKKG VEKYGPEASA FTKKMVENAK KIEVEFDKGQ RTDKYGRGLA YIYADGKMVN EALVRQGLAK VAYVYKPNNT HEQLLRKSEA QAKKEKLNIWSolvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 300 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium acetate | [U-2H] | 50 mM | |
2 | potassium chloride | natural abundance | 250 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DSS | natural abundance | 0.2 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 300 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium acetate | [U-2H] | 50 mM | |
2 | potassium chloride | natural abundance | 250 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DSS | natural abundance | 0.2 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 300 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium acetate | [U-2H] | 50 mM | |
2 | potassium chloride | natural abundance | 250 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DSS | natural abundance | 0.2 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 300 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium acetate | [U-2H] | 50 mM | |
2 | potassium chloride | natural abundance | 250 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DSS | natural abundance | 0.2 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 300 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium acetate | [U-2H] | 50 mM | |
2 | potassium chloride | natural abundance | 250 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DSS | natural abundance | 0.2 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 300 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium acetate | [U-2H] | 50 mM | |
2 | potassium chloride | natural abundance | 250 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DSS | natural abundance | 0.2 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 300 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium acetate | [U-2H] | 50 mM | |
2 | potassium chloride | natural abundance | 250 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DSS | natural abundance | 0.2 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 300 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium acetate | [U-2H] | 50 mM | |
2 | potassium chloride | natural abundance | 250 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DSS | natural abundance | 0.2 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 300 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium acetate | [U-2H] | 50 mM | |
2 | potassium chloride | natural abundance | 250 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DSS | natural abundance | 0.2 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 300 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium acetate | [U-2H] | 50 mM | |
2 | potassium chloride | natural abundance | 250 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DSS | natural abundance | 0.2 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 300 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium acetate | [U-2H] | 50 mM | |
2 | potassium chloride | natural abundance | 250 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DSS | natural abundance | 0.2 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 300 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium acetate | [U-2H] | 50 mM | |
2 | potassium chloride | natural abundance | 250 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DSS | natural abundance | 0.2 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 300 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium acetate | [U-2H] | 50 mM | |
2 | potassium chloride | natural abundance | 250 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DSS | natural abundance | 0.2 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16585_2kq3.nef |
Input source #2: Coordindates | 2kq3.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVN -------110-------120-------130-------140 EALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIW |||||||||||||||||||||||||||||||||||||||| EALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIW
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 140 | 0 | 0 | 100.0 |
Content subtype: combined_16585_2kq3.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVN |||||||||||||||||||||||||||||||||||||||||||||||||||| || |||||||||||||||||||||||||||||||||||||||||||| ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVE.YG.EASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVN -------110-------120-------130-------140 EALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIW |||||||||||||||||||||||||||||||||||||||| EALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIW
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 898 | 811 | 90.3 |
13C chemical shifts | 659 | 579 | 87.9 |
15N chemical shifts | 150 | 135 | 90.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 283 | 276 | 97.5 |
13C chemical shifts | 280 | 273 | 97.5 |
15N chemical shifts | 134 | 129 | 96.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 615 | 535 | 87.0 |
13C chemical shifts | 379 | 306 | 80.7 |
15N chemical shifts | 16 | 6 | 37.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 79 | 77 | 97.5 |
13C chemical shifts | 79 | 69 | 87.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 55 | 46 | 83.6 |
13C chemical shifts | 54 | 0 | 0.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVN |||||||||||||||||||||||||||||||||||||||| ||||||||| | |||||||||||||||||||||||||||||||||||||||||||| .TSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDT..TKHPKKGVE..G.EASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVN -------110-------120-------130-------140 EALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIW |||||||||||||||||||||||||||||||||||||||| EALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIW
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVN ||||||||||| |||||||||||||||| ||||| |||||||||||||||||||||| ||||||| |||| .......HKEPATLIKAI..DTVKLMYKGQPMTFRL.LVDTP.............PEASAFTKKMVENAKKIEVEFD...........LAYIYAD.KMVN --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140 EALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIW |||||| ||||| ||| |||||||||||||||||| EALVRQ..AKVAY.YKP.NTHEQLLRKSEAQAKKEK -------110-------120-------130------