Solution structure of Avian Thymic Hormone
AITDILSAKD IESALSSCQA ADSFNYKSFF STVGLSSKTP DQIKKVFGIL DQDKSGFIEE EELQLFLKNF SSSARVLTSA ETKAFLAAGD TDGDGKIGVE EFQSLVKA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.5 % (1154 of 1221) | 97.4 % (611 of 627) | 90.2 % (433 of 480) | 96.5 % (110 of 114) |
Backbone | 98.8 % (638 of 646) | 98.6 % (219 of 222) | 99.1 % (314 of 317) | 98.1 % (105 of 107) |
Sidechain | 91.1 % (616 of 676) | 96.8 % (392 of 405) | 83.0 % (219 of 264) | 71.4 % (5 of 7) |
Aromatic | 48.0 % (47 of 98) | 85.7 % (42 of 49) | 10.2 % (5 of 49) | |
Methyl | 98.4 % (120 of 122) | 98.4 % (60 of 61) | 98.4 % (60 of 61) |
1. ATH
AITDILSAKD IESALSSCQA ADSFNYKSFF STVGLSSKTP DQIKKVFGIL DQDKSGFIEE EELQLFLKNF SSSARVLTSA ETKAFLAAGD TDGDGKIGVE EFQSLVKASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 150 (±0.3) mM | |
2 | MES | natural abundance | 10 (±0.2) mM | |
3 | THP | natural abundance | 5 (±0.2) mM | |
4 | ATH | [U-98% 13C; U-98% 15N] | 3 (±0.3) mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium chloride | natural abundance | 150 (±0.3) mM | |
6 | MES | natural abundance | 10 (±0.2) mM | |
7 | THP | natural abundance | 5 (±0.2) mM | |
8 | ATH | [U-15% 13C; U-98% 15N] | 3 (±0.3) mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium chloride | natural abundance | 150 (±0.3) mM | |
10 | MES | natural abundance | 10 (±0.2) mM | |
11 | THP | natural abundance | 5 (±0.2) mM | |
12 | ATH | [U-98% 15N] | 3 (±0.3) mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 150 (±0.3) mM | |
2 | MES | natural abundance | 10 (±0.2) mM | |
3 | THP | natural abundance | 5 (±0.2) mM | |
4 | ATH | [U-98% 13C; U-98% 15N] | 3 (±0.3) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 150 (±0.3) mM | |
2 | MES | natural abundance | 10 (±0.2) mM | |
3 | THP | natural abundance | 5 (±0.2) mM | |
4 | ATH | [U-98% 13C; U-98% 15N] | 3 (±0.3) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 150 (±0.3) mM | |
2 | MES | natural abundance | 10 (±0.2) mM | |
3 | THP | natural abundance | 5 (±0.2) mM | |
4 | ATH | [U-98% 13C; U-98% 15N] | 3 (±0.3) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 150 (±0.3) mM | |
2 | MES | natural abundance | 10 (±0.2) mM | |
3 | THP | natural abundance | 5 (±0.2) mM | |
4 | ATH | [U-98% 13C; U-98% 15N] | 3 (±0.3) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 150 (±0.3) mM | |
2 | MES | natural abundance | 10 (±0.2) mM | |
3 | THP | natural abundance | 5 (±0.2) mM | |
4 | ATH | [U-98% 13C; U-98% 15N] | 3 (±0.3) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 150 (±0.3) mM | |
2 | MES | natural abundance | 10 (±0.2) mM | |
3 | THP | natural abundance | 5 (±0.2) mM | |
4 | ATH | [U-98% 13C; U-98% 15N] | 3 (±0.3) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 150 (±0.3) mM | |
2 | MES | natural abundance | 10 (±0.2) mM | |
3 | THP | natural abundance | 5 (±0.2) mM | |
4 | ATH | [U-98% 13C; U-98% 15N] | 3 (±0.3) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 150 (±0.3) mM | |
2 | MES | natural abundance | 10 (±0.2) mM | |
3 | THP | natural abundance | 5 (±0.2) mM | |
4 | ATH | [U-98% 13C; U-98% 15N] | 3 (±0.3) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 150 (±0.3) mM | |
2 | MES | natural abundance | 10 (±0.2) mM | |
3 | THP | natural abundance | 5 (±0.2) mM | |
4 | ATH | [U-98% 13C; U-98% 15N] | 3 (±0.3) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 150 (±0.3) mM | |
2 | MES | natural abundance | 10 (±0.2) mM | |
3 | THP | natural abundance | 5 (±0.2) mM | |
4 | ATH | [U-98% 13C; U-98% 15N] | 3 (±0.3) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 150 (±0.3) mM | |
2 | MES | natural abundance | 10 (±0.2) mM | |
3 | THP | natural abundance | 5 (±0.2) mM | |
4 | ATH | [U-98% 13C; U-98% 15N] | 3 (±0.3) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 150 (±0.3) mM | |
2 | MES | natural abundance | 10 (±0.2) mM | |
3 | THP | natural abundance | 5 (±0.2) mM | |
4 | ATH | [U-98% 13C; U-98% 15N] | 3 (±0.3) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 150 (±0.3) mM | |
2 | MES | natural abundance | 10 (±0.2) mM | |
3 | THP | natural abundance | 5 (±0.2) mM | |
4 | ATH | [U-98% 13C; U-98% 15N] | 3 (±0.3) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 150 (±0.3) mM | |
2 | MES | natural abundance | 10 (±0.2) mM | |
3 | THP | natural abundance | 5 (±0.2) mM | |
4 | ATH | [U-98% 13C; U-98% 15N] | 3 (±0.3) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 150 (±0.3) mM | |
2 | MES | natural abundance | 10 (±0.2) mM | |
3 | THP | natural abundance | 5 (±0.2) mM | |
4 | ATH | [U-98% 13C; U-98% 15N] | 3 (±0.3) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium chloride | natural abundance | 150 (±0.3) mM | |
6 | MES | natural abundance | 10 (±0.2) mM | |
7 | THP | natural abundance | 5 (±0.2) mM | |
8 | ATH | [U-15% 13C; U-98% 15N] | 3 (±0.3) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 (±0.5) K, pH 6.0 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium chloride | natural abundance | 150 (±0.3) mM | |
6 | MES | natural abundance | 10 (±0.2) mM | |
7 | THP | natural abundance | 5 (±0.2) mM | |
8 | ATH | [U-15% 13C; U-98% 15N] | 3 (±0.3) mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16617_2kqy.nef |
Input source #2: Coordindates | 2kqy.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AITDILSAKDIESALSSCQAADSFNYKSFFSTVGLSSKTPDQIKKVFGILDQDKSGFIEEEELQLFLKNFSSSARVLTSAETKAFLAAGDTDGDGKIGVE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AITDILSAKDIESALSSCQAADSFNYKSFFSTVGLSSKTPDQIKKVFGILDQDKSGFIEEEELQLFLKNFSSSARVLTSAETKAFLAAGDTDGDGKIGVE -------- EFQSLVKA |||||||| EFQSLVKA
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 108 | 0 | 0 | 100.0 |
Content subtype: combined_16617_2kqy.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AITDILSAKDIESALSSCQAADSFNYKSFFSTVGLSSKTPDQIKKVFGILDQDKSGFIEEEELQLFLKNFSSSARVLTSAETKAFLAAGDTDGDGKIGVE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .ITDILSAKDIESALSSCQAADSFNYKSFFSTVGLSSKTPDQIKKVFGILDQDKSGFIEEEELQLFLKNFSSSARVLTSAETKAFLAAGDTDGDGKIGVE -------- EFQSLVKA |||||||| EFQSLVKA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 627 | 609 | 97.1 |
13C chemical shifts | 480 | 428 | 89.2 |
15N chemical shifts | 115 | 110 | 95.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 222 | 219 | 98.6 |
13C chemical shifts | 216 | 214 | 99.1 |
15N chemical shifts | 107 | 105 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 405 | 390 | 96.3 |
13C chemical shifts | 264 | 214 | 81.1 |
15N chemical shifts | 8 | 5 | 62.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 60 | 98.4 |
13C chemical shifts | 61 | 60 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 40 | 81.6 |
13C chemical shifts | 49 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AITDILSAKDIESALSSCQAADSFNYKSFFSTVGLSSKTPDQIKKVFGILDQDKSGFIEEEELQLFLKNFSSSARVLTSAETKAFLAAGDTDGDGKIGVE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .ITDILSAKDIESALSSCQAADSFNYKSFFSTVGLSSKTPDQIKKVFGILDQDKSGFIEEEELQLFLKNFSSSARVLTSAETKAFLAAGDTDGDGKIGVE -------- EFQSLVKA |||||||| EFQSLVKA
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AITDILSAKDIESALSSCQAADSFNYKSFFSTVGLSSKTPDQIKKVFGILDQDKSGFIEEEELQLFLKNFSSSARVLTSAETKAFLAAGDTDGDGKIGVE ||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||| ||||| ||||||||||||||| |||||||| .ITDILSAKDIESALSSCQAADSFNYKSFFSTVGLSSK.PDQIKKVFGILDQDKSGFIEEEELQLFLKN.SSSAR.LTSAETKAFLAAGDT.GDGKIGVE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------- EFQSLVKA ||||| EFQSL -----