NMR solution structure of the DNA binding domain of Competence protein A
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.3 % (708 of 840) | 78.4 % (342 of 436) | 90.5 % (294 of 325) | 91.1 % (72 of 79) |
Backbone | 95.6 % (417 of 436) | 95.3 % (142 of 149) | 95.3 % (205 of 215) | 97.2 % (70 of 72) |
Sidechain | 75.7 % (358 of 473) | 69.7 % (200 of 287) | 87.2 % (156 of 179) | 28.6 % (2 of 7) |
Aromatic | 0.0 % (0 of 36) | 0.0 % (0 of 18) | 0.0 % (0 of 18) | |
Methyl | 94.6 % (87 of 92) | 91.3 % (42 of 46) | 97.8 % (45 of 46) |
1. ComAC
GSHMSSQKEQ DVLTPRECLI LQEVEKGFTN QEIADALHLS KRSIEYSLTS IFNKLNVGSR TEAVLIAKSD GVLSolvent system 90% H2O/10% D2O, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | ComAC | [U-13C; U-15N] | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium phosphate | natural abundance | 25 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | EDTA | natural abundance | 2 mM | |
12 | ComAC | [U-13C; U-15N] | 1 mM | |
13 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | ComAC | [U-13C; U-15N] | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | ComAC | [U-13C; U-15N] | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | ComAC | [U-13C; U-15N] | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | ComAC | [U-13C; U-15N] | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | ComAC | [U-13C; U-15N] | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | ComAC | [U-13C; U-15N] | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | ComAC | [U-13C; U-15N] | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | ComAC | [U-13C; U-15N] | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium phosphate | natural abundance | 25 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | EDTA | natural abundance | 2 mM | |
12 | ComAC | [U-13C; U-15N] | 1 mM | |
13 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | ComAC | [U-13C; U-15N] | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | ComAC | [U-13C; U-15N] | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 288 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | ComAC | [U-13C; U-15N] | 1 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_16636_2krf.nef |
Input source #2: Coordindates | 2krf.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------150-------160-------170-------180-------190-------200-------210---- GSHMSSQKEQDVLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMSSQKEQDVLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL --------10--------20--------30--------40--------50--------60--------70---
------150-------160-------170-------180-------190-------200-------210---- GSHMSSQKEQDVLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMSSQKEQDVLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL --------10--------20--------30--------40--------50--------60--------70---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 73 | 0 | 0 | 100.0 |
B | B | 73 | 0 | 0 | 100.0 |
Content subtype: combined_16636_2krf.nef
Assigned chemical shifts
------150-------160-------170-------180-------190-------200-------210---- GSHMSSQKEQDVLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SHMSSQKEQDVLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
170 | THR | HG1 | 1.775 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 436 | 316 | 72.5 |
13C chemical shifts | 325 | 292 | 89.8 |
15N chemical shifts | 82 | 69 | 84.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 149 | 143 | 96.0 |
13C chemical shifts | 146 | 139 | 95.2 |
15N chemical shifts | 72 | 69 | 95.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 287 | 173 | 60.3 |
13C chemical shifts | 179 | 153 | 85.5 |
15N chemical shifts | 10 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 47 | 40 | 85.1 |
13C chemical shifts | 47 | 42 | 89.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 18 | 0 | 0.0 |
13C chemical shifts | 18 | 0 | 0.0 |
Distance restraints
------150-------160-------170-------180-------190-------200-------210---- GSHMSSQKEQDVLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..HMSSQKEQDVLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL
------150-------160-------170-------180-------190-------200-------210---- GSHMSSQKEQDVLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..HMSSQKEQDVLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL
------150-------160-------170-------180-------190-------200-------210---- GSHMSSQKEQDVLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL ||||||||||||| ||||||||| | | || ||| || ||| |||| ||| .............TPRECLILQEVEK..TNQEIADAL..S...I..SL.SIF.KL....RTE.VLIA.SDG ------150-------160-------170-------180-------190-------200-------210--
------150-------160-------170-------180-------190-------200-------210---- GSHMSSQKEQDVLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL ||||||||||||| ||||||||| | | || ||| || ||| |||| ||| .............TPRECLILQEVEK..TNQEIADAL..S...I..SL.SIF.KL....RTE.VLIA.SDG ------150-------160-------170-------180-------190-------200-------210--