Solution Structure of human sodium/ hydrogen exchange regulatory factor 1(150-358).
GIDPFTMLRP RLCTMKKGPS GYGFNLHSDK SKPGQFIRSV DPDSPAEASG LRAQDRIVEV NGVCMEGKQH GDVVSAIRAG GDETKLLVVD RETDEFFKKC RVIPSQEHLN GPLPVPFTNG EIQKENSREA LAEAALESPR PALVRSASSD TSEELNSQDS PPKQDSTAPS STSSSDPILD FNISLAMAKE RAHQKRSSKR APQMDWSKKN ELFSNL
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.4 % (2062 of 2442) | 84.9 % (1094 of 1288) | 84.0 % (786 of 936) | 83.5 % (182 of 218) |
Backbone | 88.9 % (1122 of 1262) | 89.0 % (381 of 428) | 89.6 % (569 of 635) | 86.4 % (172 of 199) |
Sidechain | 81.6 % (1128 of 1383) | 83.0 % (714 of 860) | 80.2 % (404 of 504) | 52.6 % (10 of 19) |
Aromatic | 54.3 % (63 of 116) | 72.4 % (42 of 58) | 35.1 % (20 of 57) | 100.0 % (1 of 1) |
Methyl | 98.9 % (186 of 188) | 98.9 % (93 of 94) | 98.9 % (93 of 94) |
1. NHERF1 (150-358)
GIDPFTMLRP RLCTMKKGPS GYGFNLHSDK SKPGQFIRSV DPDSPAEASG LRAQDRIVEV NGVCMEGKQH GDVVSAIRAG GDETKLLVVD RETDEFFKKC RVIPSQEHLN GPLPVPFTNG EIQKENSREA LAEAALESPR PALVRSASSD TSEELNSQDS PPKQDSTAPS STSSSDPILD FNISLAMAKE RAHQKRSSKR APQMDWSKKN ELFSNLSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NHERF1 (150-358) | [U-100% 13C; U-100% 15N] | 557 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | NHERF1 (150-358) | [U-100% 13C; U-100% 15N; U-80% 2H] | 389 uM | |
8 | HEPES | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | DTT | natural abundance | 0.5 mM | |
11 | PMSF | natural abundance | 0.1 mM | |
12 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details Selectively Labeled Sample.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | NHERF1 (150-358) | [U-100% 13C; U-100% 15N]-Leu,Val,Phe | 413 uM | |
14 | HEPES | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 150 mM | |
16 | DTT | natural abundance | 0.5 mM | |
17 | PMSF | natural abundance | 0.1 mM | |
18 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NHERF1 (150-358) | [U-100% 13C; U-100% 15N] | 557 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NHERF1 (150-358) | [U-100% 13C; U-100% 15N] | 557 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NHERF1 (150-358) | [U-100% 13C; U-100% 15N] | 557 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NHERF1 (150-358) | [U-100% 13C; U-100% 15N] | 557 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NHERF1 (150-358) | [U-100% 13C; U-100% 15N] | 557 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NHERF1 (150-358) | [U-100% 13C; U-100% 15N] | 557 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NHERF1 (150-358) | [U-100% 13C; U-100% 15N] | 557 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | NHERF1 (150-358) | [U-100% 13C; U-100% 15N; U-80% 2H] | 389 uM | |
8 | HEPES | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | DTT | natural abundance | 0.5 mM | |
11 | PMSF | natural abundance | 0.1 mM | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details Selectively Labeled Sample.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | NHERF1 (150-358) | [U-100% 13C; U-100% 15N]-Leu,Val,Phe | 413 uM | |
14 | HEPES | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 150 mM | |
16 | DTT | natural abundance | 0.5 mM | |
17 | PMSF | natural abundance | 0.1 mM | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NHERF1 (150-358) | [U-100% 13C; U-100% 15N] | 557 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NHERF1 (150-358) | [U-100% 13C; U-100% 15N] | 557 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details Selectively Labeled Sample.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | NHERF1 (150-358) | [U-100% 13C; U-100% 15N]-Leu,Val,Phe | 413 uM | |
14 | HEPES | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 150 mM | |
16 | DTT | natural abundance | 0.5 mM | |
17 | PMSF | natural abundance | 0.1 mM | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5, Details Selectively Labeled Sample.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | NHERF1 (150-358) | [U-100% 13C; U-100% 15N]-Leu,Val,Phe | 413 uM | |
14 | HEPES | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 150 mM | |
16 | DTT | natural abundance | 0.5 mM | |
17 | PMSF | natural abundance | 0.1 mM | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NHERF1 (150-358) | [U-100% 13C; U-100% 15N] | 557 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NHERF1 (150-358) | [U-100% 13C; U-100% 15N] | 557 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NHERF1 (150-358) | [U-100% 13C; U-100% 15N] | 557 uM | |
2 | HEPES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 0.5 mM | |
5 | PMSF | natural abundance | 0.1 mM | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16638_2krg.nef |
Input source #2: Coordindates | 2krg.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----150-------160-------170-------180-------190-------200-------210-------220-------230-------240-- GIDPFTMLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GIDPFTMLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKC --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -----250-------260-------270-------280-------290-------300-------310-------320-------330-------340-- RVIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALESPRPALVRSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAHQKRSSKR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RVIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALESPRPALVRSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAHQKRSSKR -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 -----350-------- APQMDWSKKNELFSNL |||||||||||||||| APQMDWSKKNELFSNL -------210------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 216 | 0 | 0 | 100.0 |
Content subtype: combined_16638_2krg.nef
Assigned chemical shifts
-----150-------160-------170-------180-------190-------200-------210-------220-------230-------240-- GIDPFTMLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKC ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .IDPFTMLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKC -----250-------260-------270-------280-------290-------300-------310-------320-------330-------340-- RVIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALESPRPALVRSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAHQKRSSKR |||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||| || RVIPSQEHLNGPLPVPFTNGEIQKEN.REALAEAALESPRPALVRSASSDTSEELNSQDSPPKQDSTAPSST..SDPILDFNISLAMAKERAHQ....KR -----350-------- APQMDWSKKNELFSNL ||| | | | APQ..W.....L...L
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
153 | ARG | HH11 | 6.855 |
153 | ARG | HH12 | 6.855 |
153 | ARG | NH1 | 83.576 |
186 | SER | HG | 6.656 |
191 | SER | HG | 5.097 |
226 | THR | HG1 | 4.163 |
235 | THR | HG1 | 6.123 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1288 | 1049 | 81.4 |
13C chemical shifts | 936 | 758 | 81.0 |
15N chemical shifts | 232 | 173 | 74.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 428 | 367 | 85.7 |
13C chemical shifts | 432 | 369 | 85.4 |
15N chemical shifts | 199 | 164 | 82.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 860 | 682 | 79.3 |
13C chemical shifts | 504 | 389 | 77.2 |
15N chemical shifts | 33 | 9 | 27.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 99 | 93 | 93.9 |
13C chemical shifts | 99 | 94 | 94.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 40 | 69.0 |
13C chemical shifts | 57 | 20 | 35.1 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
-----150-------160-------170-------180-------190-------200-------210-------220-------230-------240-- GIDPFTMLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKC ||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .IDPFTMLRPRLCTMKKGPSGYGFNL..DKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKC -----250-------260-------270-------280-------290-------300-------310-------320-------330-------340-- RVIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALESPRPALVRSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAHQKRSSKR ||||||||||||||||||||||||| |||||||||||||||||| |||||||||||||| ||| ||||||||||||||||||| || RVIPSQEHLNGPLPVPFTNGEIQKE..REALAEAALESPRPALVR....DTSEELNSQDSPPK...TAP.....SDPILDFNISLAMAKERAH.....KR -----350-------- APQMDWSKKNELFSNL | ...............L
Dihedral angle restraints