Solution NMR Structure of a Conserved Hypothetical Membrane Lipoprotein Obtained from Ureaplasma parvum: Northeast Structural Genomics Consortium Target UuR17A (139-239)
MLSQANEDFK KIVNNIRLKD TFDFKLAAFP NQNYDQLLPS QIYKNYYQGI EIQQHKYQNE LDIKIINFLY PDGDFGSANK NGTLKLSLML TDKKNNQVYY KLLEVSGFKS NPYLEHHHHH H
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.3 % (1286 of 1526) | 82.3 % (660 of 802) | 86.5 % (506 of 585) | 86.3 % (120 of 139) |
Backbone | 91.2 % (655 of 718) | 91.4 % (222 of 243) | 90.8 % (325 of 358) | 92.3 % (108 of 117) |
Sidechain | 80.1 % (740 of 924) | 78.4 % (438 of 559) | 84.5 % (290 of 343) | 54.5 % (12 of 22) |
Aromatic | 61.2 % (104 of 170) | 60.0 % (51 of 85) | 62.4 % (53 of 85) | |
Methyl | 93.9 % (107 of 114) | 93.0 % (53 of 57) | 94.7 % (54 of 57) |
1. UuR17A, Lipoprotein
MLSQANEDFK KIVNNIRLKD TFDFKLAAFP NQNYDQLLPS QIYKNYYQGI EIQQHKYQNE LDIKIINFLY PDGDFGSANK NGTLKLSLML TDKKNNQVYY KLLEVSGFKS NPYLEHHHHH HSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.91mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UuR17A, Lipoprotein | [U-100% 13C; U-100% 15N] | 0.91 (±0.2) mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DDT | natural abundance | 100 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | NaCl | natural abundance | 10 mM | |
6 | MES | natural abundance | 20 mM |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.91mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UuR17A, Lipoprotein | [U-100% 13C; U-100% 15N] | 0.91 (±0.2) mM | |
8 | NaN3 | natural abundance | 0.02 % | |
9 | DDT | natural abundance | 100 mM | |
10 | CaCl2 | natural abundance | 5 mM | |
11 | NaCl | natural abundance | 10 mM | |
12 | MES | natural abundance | 20 mM |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | UuR17A, Lipoprotein | [U-10% 13C; U-99% 15N] | 0.7 (±0.2) mM | |
14 | NaN3 | natural abundance | 0.02 % | |
15 | DDT | natural abundance | 100 mM | |
16 | CaCl2 | natural abundance | 5 mM | |
17 | NaCl | natural abundance | 10 mM | |
18 | MES | natural abundance | 20 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.91mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UuR17A, Lipoprotein | [U-100% 13C; U-100% 15N] | 0.91 (±0.2) mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DDT | natural abundance | 100 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | NaCl | natural abundance | 10 mM | |
6 | MES | natural abundance | 20 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.91mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UuR17A, Lipoprotein | [U-100% 13C; U-100% 15N] | 0.91 (±0.2) mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DDT | natural abundance | 100 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | NaCl | natural abundance | 10 mM | |
6 | MES | natural abundance | 20 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.91mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UuR17A, Lipoprotein | [U-100% 13C; U-100% 15N] | 0.91 (±0.2) mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DDT | natural abundance | 100 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | NaCl | natural abundance | 10 mM | |
6 | MES | natural abundance | 20 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.91mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UuR17A, Lipoprotein | [U-100% 13C; U-100% 15N] | 0.91 (±0.2) mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DDT | natural abundance | 100 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | NaCl | natural abundance | 10 mM | |
6 | MES | natural abundance | 20 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.91mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UuR17A, Lipoprotein | [U-100% 13C; U-100% 15N] | 0.91 (±0.2) mM | |
8 | NaN3 | natural abundance | 0.02 % | |
9 | DDT | natural abundance | 100 mM | |
10 | CaCl2 | natural abundance | 5 mM | |
11 | NaCl | natural abundance | 10 mM | |
12 | MES | natural abundance | 20 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.91mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UuR17A, Lipoprotein | [U-100% 13C; U-100% 15N] | 0.91 (±0.2) mM | |
8 | NaN3 | natural abundance | 0.02 % | |
9 | DDT | natural abundance | 100 mM | |
10 | CaCl2 | natural abundance | 5 mM | |
11 | NaCl | natural abundance | 10 mM | |
12 | MES | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.91mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UuR17A, Lipoprotein | [U-100% 13C; U-100% 15N] | 0.91 (±0.2) mM | |
8 | NaN3 | natural abundance | 0.02 % | |
9 | DDT | natural abundance | 100 mM | |
10 | CaCl2 | natural abundance | 5 mM | |
11 | NaCl | natural abundance | 10 mM | |
12 | MES | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.91mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UuR17A, Lipoprotein | [U-100% 13C; U-100% 15N] | 0.91 (±0.2) mM | |
8 | NaN3 | natural abundance | 0.02 % | |
9 | DDT | natural abundance | 100 mM | |
10 | CaCl2 | natural abundance | 5 mM | |
11 | NaCl | natural abundance | 10 mM | |
12 | MES | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.91mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UuR17A, Lipoprotein | [U-100% 13C; U-100% 15N] | 0.91 (±0.2) mM | |
8 | NaN3 | natural abundance | 0.02 % | |
9 | DDT | natural abundance | 100 mM | |
10 | CaCl2 | natural abundance | 5 mM | |
11 | NaCl | natural abundance | 10 mM | |
12 | MES | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.91mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UuR17A, Lipoprotein | [U-100% 13C; U-100% 15N] | 0.91 (±0.2) mM | |
8 | NaN3 | natural abundance | 0.02 % | |
9 | DDT | natural abundance | 100 mM | |
10 | CaCl2 | natural abundance | 5 mM | |
11 | NaCl | natural abundance | 10 mM | |
12 | MES | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.91mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UuR17A, Lipoprotein | [U-100% 13C; U-100% 15N] | 0.91 (±0.2) mM | |
8 | NaN3 | natural abundance | 0.02 % | |
9 | DDT | natural abundance | 100 mM | |
10 | CaCl2 | natural abundance | 5 mM | |
11 | NaCl | natural abundance | 10 mM | |
12 | MES | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.91mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UuR17A, Lipoprotein | [U-100% 13C; U-100% 15N] | 0.91 (±0.2) mM | |
8 | NaN3 | natural abundance | 0.02 % | |
9 | DDT | natural abundance | 100 mM | |
10 | CaCl2 | natural abundance | 5 mM | |
11 | NaCl | natural abundance | 10 mM | |
12 | MES | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.91mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UuR17A, Lipoprotein | [U-100% 13C; U-100% 15N] | 0.91 (±0.2) mM | |
8 | NaN3 | natural abundance | 0.02 % | |
9 | DDT | natural abundance | 100 mM | |
10 | CaCl2 | natural abundance | 5 mM | |
11 | NaCl | natural abundance | 10 mM | |
12 | MES | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.91mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UuR17A, Lipoprotein | [U-100% 13C; U-100% 15N] | 0.91 (±0.2) mM | |
8 | NaN3 | natural abundance | 0.02 % | |
9 | DDT | natural abundance | 100 mM | |
10 | CaCl2 | natural abundance | 5 mM | |
11 | NaCl | natural abundance | 10 mM | |
12 | MES | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.91mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UuR17A, Lipoprotein | [U-100% 13C; U-100% 15N] | 0.91 (±0.2) mM | |
8 | NaN3 | natural abundance | 0.02 % | |
9 | DDT | natural abundance | 100 mM | |
10 | CaCl2 | natural abundance | 5 mM | |
11 | NaCl | natural abundance | 10 mM | |
12 | MES | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.91mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UuR17A, Lipoprotein | [U-100% 13C; U-100% 15N] | 0.91 (±0.2) mM | |
8 | NaN3 | natural abundance | 0.02 % | |
9 | DDT | natural abundance | 100 mM | |
10 | CaCl2 | natural abundance | 5 mM | |
11 | NaCl | natural abundance | 10 mM | |
12 | MES | natural abundance | 20 mM |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | UuR17A, Lipoprotein | [U-10% 13C; U-99% 15N] | 0.7 (±0.2) mM | |
14 | NaN3 | natural abundance | 0.02 % | |
15 | DDT | natural abundance | 100 mM | |
16 | CaCl2 | natural abundance | 5 mM | |
17 | NaCl | natural abundance | 10 mM | |
18 | MES | natural abundance | 20 mM |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | UuR17A, Lipoprotein | [U-10% 13C; U-99% 15N] | 0.7 (±0.2) mM | |
14 | NaN3 | natural abundance | 0.02 % | |
15 | DDT | natural abundance | 100 mM | |
16 | CaCl2 | natural abundance | 5 mM | |
17 | NaCl | natural abundance | 10 mM | |
18 | MES | natural abundance | 20 mM |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7mM, 5%D2O, 0.02% NaN3, 100mM DDT, 5mM CaCl2, 10mM NaCl, 20mM MES, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | UuR17A, Lipoprotein | [U-10% 13C; U-99% 15N] | 0.7 (±0.2) mM | |
14 | NaN3 | natural abundance | 0.02 % | |
15 | DDT | natural abundance | 100 mM | |
16 | CaCl2 | natural abundance | 5 mM | |
17 | NaCl | natural abundance | 10 mM | |
18 | MES | natural abundance | 20 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16648_2krt.nef |
Input source #2: Coordindates | 2krt.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLSQANEDFKKIVNNIRLKDTFDFKLAAFPNQNYDQLLPSQIYKNYYQGIEIQQHKYQNELDIKIINFLYPDGDFGSANKNGTLKLSLMLTDKKNNQVYY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MLSQANEDFKKIVNNIRLKDTFDFKLAAFPNQNYDQLLPSQIYKNYYQGIEIQQHKYQNELDIKIINFLYPDGDFGSANKNGTLKLSLMLTDKKNNQVYY -------110-------120- KLLEVSGFKSNPYLEHHHHHH ||||||||||||||||||||| KLLEVSGFKSNPYLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 121 | 0 | 0 | 100.0 |
Content subtype: combined_16648_2krt.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLSQANEDFKKIVNNIRLKDTFDFKLAAFPNQNYDQLLPSQIYKNYYQGIEIQQHKYQNELDIKIINFLYPDGDFGSANKNGTLKLSLMLTDKKNNQVYY ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||| .LSQANEDFKKIVNNIRLKDTFDFKLAAFPNQNYDQLLPSQIYKNYYQGIEIQQHKYQNELDIKIINFLY.DGDFGSANKNGTLKLSLMLTDKKNNQVYY --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120- KLLEVSGFKSNPYLEHHHHHH ||||||||||||||||| KLLEVSGFKSNPYLEHH -------110-------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 802 | 669 | 83.4 |
13C chemical shifts | 585 | 508 | 86.8 |
15N chemical shifts | 140 | 120 | 85.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 243 | 226 | 93.0 |
13C chemical shifts | 242 | 215 | 88.8 |
15N chemical shifts | 117 | 108 | 92.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 559 | 443 | 79.2 |
13C chemical shifts | 343 | 293 | 85.4 |
15N chemical shifts | 23 | 12 | 52.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 59 | 53 | 89.8 |
13C chemical shifts | 59 | 54 | 91.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 85 | 51 | 60.0 |
13C chemical shifts | 85 | 53 | 62.4 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLSQANEDFKKIVNNIRLKDTFDFKLAAFPNQNYDQLLPSQIYKNYYQGIEIQQHKYQNELDIKIINFLYPDGDFGSANKNGTLKLSLMLTDKKNNQVYY ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||| .LSQANEDFKKIVNNIRLKDTFDFKLAAFPNQNYDQLLPSQIYKNYYQGIEIQQHKYQNELDIKIINFLY.DGDFGSANKNGTLKLSLMLTDKKNNQVYY --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120- KLLEVSGFKSNPYLEHHHHHH ||||||||||||||||| KLLEVSGFKSNPYLEHH -------110-------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLSQANEDFKKIVNNIRLKDTFDFKLAAFPNQNYDQLLPSQIYKNYYQGIEIQQHKYQNELDIKIINFLYPDGDFGSANKNGTLKLSLMLTDKKNNQVYY |||||||||||| ||||||||||| ||||||||||||||||| |||||| ||||| ||||||||||||||||||| ||||| ....ANEDFKKIVNNI..KDTFDFKLAAF.........PSQIYKNYYQGIEIQQH....ELDIKI.NFLYP...FGSANKNGTLKLSLMLTDK..NQVYY --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120- KLLEVSGFKSNPYLEHHHHHH ||||||| ||| KLLEVSG..SNP -------110--