Solution NMR structure of apo Sterol Carrier Protein - 2 from Aedes aegypti (AeSCP-2)
MSLKSDEVFA KIAKRLESID PANRQVEHVY KFRITQGGKV VKNWVMDLKN VKLVESDDAA EATLTMEDDI MFAIGTGALP AKEAMAQDKM EVDGQVELIF LLEPFIASLK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.4 % (1156 of 1293) | 97.8 % (656 of 671) | 76.3 % (387 of 507) | 98.3 % (113 of 115) |
Backbone | 84.1 % (550 of 654) | 99.1 % (220 of 222) | 69.2 % (225 of 325) | 98.1 % (105 of 107) |
Sidechain | 95.4 % (710 of 744) | 97.1 % (436 of 449) | 92.7 % (266 of 287) | 100.0 % (8 of 8) |
Aromatic | 81.1 % (60 of 74) | 100.0 % (37 of 37) | 61.1 % (22 of 36) | 100.0 % (1 of 1) |
Methyl | 100.0 % (140 of 140) | 100.0 % (70 of 70) | 100.0 % (70 of 70) |
1. AeSCP-2
MSLKSDEVFA KIAKRLESID PANRQVEHVY KFRITQGGKV VKNWVMDLKN VKLVESDDAA EATLTMEDDI MFAIGTGALP AKEAMAQDKM EVDGQVELIF LLEPFIASLKSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2 | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | AeSCP-2 | [U-100% 15N] | 1 mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AeSCP-2 | [U-100% 15N] | 1 mM | |
8 | H2O | natural abundance | 93 % | |
9 | D2O | natural abundance | 7 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Pressure 1 atm, Temperature 298 K, pH 7.8
Experiment name 2D 1H-15N TROSY, 2D 1H-15N HSQC
List #1 RDC_list_1, RDC code DHN, Field strength (1H) 600 MHz, Details #Orientation Magnitude Rhombicity ORI residue number 1 23.341 0.456 200
Varian INOVA - 900 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2 | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian INOVA - 900 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2 | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian INOVA - 900 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2 | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian INOVA - 900 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2 | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian INOVA - 900 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2 | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian INOVA - 900 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2 | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian INOVA - 900 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2 | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian INOVA - 900 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2 | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian INOVA - 900 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2 | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian INOVA - 900 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | AeSCP-2 | [U-100% 15N] | 1 mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 900 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | AeSCP-2 | [U-100% 15N] | 1 mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 900 MHz
State anisotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AeSCP-2 | [U-100% 15N] | 1 mM | |
8 | H2O | natural abundance | 93 % | |
9 | D2O | natural abundance | 7 % |
Varian INOVA - 900 MHz
State anisotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AeSCP-2 | [U-100% 15N] | 1 mM | |
8 | H2O | natural abundance | 93 % | |
9 | D2O | natural abundance | 7 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_16662_2ksh.nef |
Input source #2: Coordindates | 2ksh.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIF |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIF -------110 LLEPFIASLK |||||||||| LLEPFIASLK
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 110 | 0 | 0 | 100.0 |
Content subtype: combined_16662_2ksh.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIF ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIF -------110 LLEPFIASLK |||||||||| LLEPFIASLK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
5 | SER | HG | 6.249 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 671 | 656 | 97.8 |
13C chemical shifts | 507 | 375 | 74.0 |
15N chemical shifts | 118 | 113 | 95.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 222 | 220 | 99.1 |
13C chemical shifts | 220 | 109 | 49.5 |
15N chemical shifts | 107 | 105 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 449 | 436 | 97.1 |
13C chemical shifts | 287 | 266 | 92.7 |
15N chemical shifts | 11 | 8 | 72.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 76 | 72 | 94.7 |
13C chemical shifts | 76 | 72 | 94.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 37 | 37 | 100.0 |
13C chemical shifts | 36 | 22 | 61.1 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIF ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIF -------110 LLEPFIASLK |||||||||| LLEPFIASLK
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIF |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIF --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110 LLEPFIASLK ||||||||| LLEPFIASL ---------
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIF ||||||||||| | |||| ||||||||||||| |||||||||||||||||| ||||||||| ||||||| ||| || ||||||||||||| .SLKSDEVFAKI..R.ESID........VYKFRITQGGKVV.NWVMDLKNVKLVESDDAA.ATLTMEDDI.FAIGTGA..AKE.MA.DKMEVDGQVELIF --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110 LLEPFIASLK ||| | || LLE.F..SL ---------