Solution NMR structure of Sterol Carrier Protein - 2 from Aedes aegypti (AeSCP-2) complex with C16 fatty acid (palmitate)
MSLKSDEVFA KIAKRLESID PANRQVEHVY KFRITQGGKV VKNWVMDLKN VKLVESDDAA EATLTMEDDI MFAIGTGALP AKEAMAQDKM EVDGQVELIF LLEPFIASLK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.3 % (1129 of 1293) | 93.0 % (624 of 671) | 77.5 % (393 of 507) | 97.4 % (112 of 115) |
Backbone | 83.5 % (546 of 654) | 94.6 % (210 of 222) | 71.1 % (231 of 325) | 98.1 % (105 of 107) |
Sidechain | 92.2 % (686 of 744) | 92.2 % (414 of 449) | 92.3 % (265 of 287) | 87.5 % (7 of 8) |
Aromatic | 82.4 % (61 of 74) | 100.0 % (37 of 37) | 66.7 % (24 of 36) | 0.0 % (0 of 1) |
Methyl | 97.9 % (137 of 140) | 97.1 % (68 of 70) | 98.6 % (69 of 70) |
1. AeSCP-2-PA
MSLKSDEVFA KIAKRLESID PANRQVEHVY KFRITQGGKV VKNWVMDLKN VKLVESDDAA EATLTMEDDI MFAIGTGALP AKEAMAQDKM EVDGQVELIF LLEPFIASLKSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2-PA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | AeSCP-2-PA | [U-100% 15N] | 1 mM |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | AeSCP-2-PA | [U-100% 15N] | 2 mM |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | AeSCP-2-PA | [U-100% 15N] | 2 mM |
Pressure 1 atm, Temperature 298 K, pH 7.8
Experiment name 2D 1H-15N TROSY, 2D 1H-15N HSQC
List #1 RDC_list_1, RDC code DHN, Field strength (1H) 600 MHz
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2-PA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | AeSCP-2-PA | [U-100% 15N] | 1 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2-PA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | AeSCP-2-PA | [U-100% 15N] | 1 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2-PA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | AeSCP-2-PA | [U-100% 15N] | 1 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2-PA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | AeSCP-2-PA | [U-100% 15N] | 1 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2-PA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | AeSCP-2-PA | [U-100% 15N] | 1 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2-PA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | AeSCP-2-PA | [U-100% 15N] | 1 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2-PA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | AeSCP-2-PA | [U-100% 15N] | 1 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2-PA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | AeSCP-2-PA | [U-100% 15N] | 1 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2-PA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | AeSCP-2-PA | [U-100% 15N] | 1 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AeSCP-2-PA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | AeSCP-2-PA | [U-100% 15N] | 1 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | AeSCP-2-PA | [U-100% 15N] | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | AeSCP-2-PA | [U-100% 15N] | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | AeSCP-2-PA | [U-100% 15N] | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | AeSCP-2-PA | [U-100% 15N] | 2 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_16665_2ksi.nef |
Input source #2: Coordindates | 2ksi.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | PLM | PALMITIC ACID | Assigned chemical shifts, Distance restraints |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIF |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIF -------110 LLEPFIASLK |||||||||| LLEPFIASLK
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 110 | 0 | 0 | 100.0 |
Content subtype: combined_16665_2ksi.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIF ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIF -------110 LLEPFIASLK |||||||||| LLEPFIASLK
- X | X
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
5 | SER | HG | 6.246 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 671 | 642 | 95.7 |
13C chemical shifts | 507 | 376 | 74.2 |
15N chemical shifts | 118 | 112 | 94.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 222 | 220 | 99.1 |
13C chemical shifts | 220 | 109 | 49.5 |
15N chemical shifts | 107 | 105 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 449 | 422 | 94.0 |
13C chemical shifts | 287 | 267 | 93.0 |
15N chemical shifts | 11 | 7 | 63.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 76 | 72 | 94.7 |
13C chemical shifts | 76 | 72 | 94.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 37 | 37 | 100.0 |
13C chemical shifts | 36 | 24 | 66.7 |
15N chemical shifts | 1 | 0 | 0.0 |
Comp_index_ID | Comp_ID |
---|---|
1 | PLM |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIF ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIF -------110 LLEPFIASLK |||||||||| LLEPFIASLK
- X | X
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIF |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIF -------110 LLEPFIASLK |||||||||| LLEPFIASLK
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIF |||||||||||||| | | ||||| ||||||||||||||||| |||||||||||||||||||||||||| |||||||||||||| ||||| ..LKSDEVFAKIAKRL...D.....V...YKFRI.QGGKVVKNWVMDLKNVK.VESDDAAEATLTMEDDIMFAIGTGAL.AKEAMAQDKMEVDG.VELIF -------110 LLEPFIASLK ||| |||||| LLE.FIASLK