Solution NMR Structure of the SH3 Domain from the p85beta subunit of Phosphatidylinositol 3-kinase from H.sapiens. Northeast Structural Genomics Consortium Target HR5531E.
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.6 % (879 of 1015) | 85.3 % (454 of 532) | 88.2 % (350 of 397) | 87.2 % (75 of 86) |
Backbone | 89.1 % (456 of 512) | 88.3 % (158 of 179) | 90.1 % (228 of 253) | 87.5 % (70 of 80) |
Sidechain | 85.0 % (493 of 580) | 83.9 % (296 of 353) | 86.9 % (192 of 221) | 83.3 % (5 of 6) |
Aromatic | 66.0 % (66 of 100) | 66.0 % (33 of 50) | 67.3 % (33 of 49) | 0.0 % (0 of 1) |
Methyl | 97.5 % (78 of 80) | 95.0 % (38 of 40) | 100.0 % (40 of 40) |
1. HR5531E
MAGPEGFQYR ALYPFRRERP EDLELLPGDV LVVSRAALQA LGVAEGGERC PQSVGWMPGL NERTRQRGDF PGTYVEFLGP LEHHHHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.62 mM [U-100% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR5531E | [U-100% 13C; U-100% 15N] | 0.62 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.5 mM [U-5% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | HR5531E | [U-5% 13C; U-100% 15N] | 0.50 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | DSS | natural abundance | 50 uM | |
12 | DTT | natural abundance | 10 mM | |
13 | H2O | natural abundance | 95 % | |
14 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.62 mM [U-100% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR5531E | [U-100% 13C; U-100% 15N] | 0.62 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.62 mM [U-100% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR5531E | [U-100% 13C; U-100% 15N] | 0.62 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.62 mM [U-100% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR5531E | [U-100% 13C; U-100% 15N] | 0.62 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.62 mM [U-100% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR5531E | [U-100% 13C; U-100% 15N] | 0.62 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.62 mM [U-100% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR5531E | [U-100% 13C; U-100% 15N] | 0.62 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz 5-mm TXI cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.62 mM [U-100% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR5531E | [U-100% 13C; U-100% 15N] | 0.62 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.62 mM [U-100% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR5531E | [U-100% 13C; U-100% 15N] | 0.62 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.62 mM [U-100% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR5531E | [U-100% 13C; U-100% 15N] | 0.62 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.62 mM [U-100% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR5531E | [U-100% 13C; U-100% 15N] | 0.62 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.62 mM [U-100% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR5531E | [U-100% 13C; U-100% 15N] | 0.62 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.62 mM [U-100% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR5531E | [U-100% 13C; U-100% 15N] | 0.62 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.62 mM [U-100% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR5531E | [U-100% 13C; U-100% 15N] | 0.62 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.62 mM [U-100% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR5531E | [U-100% 13C; U-100% 15N] | 0.62 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.62 mM [U-100% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR5531E | [U-100% 13C; U-100% 15N] | 0.62 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.62 mM [U-100% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR5531E | [U-100% 13C; U-100% 15N] | 0.62 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.62 mM [U-100% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR5531E | [U-100% 13C; U-100% 15N] | 0.62 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.62 mM [U-100% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR5531E | [U-100% 13C; U-100% 15N] | 0.62 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DSS | natural abundance | 50 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.5 mM [U-5% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | HR5531E | [U-5% 13C; U-100% 15N] | 0.50 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | DSS | natural abundance | 50 uM | |
12 | DTT | natural abundance | 10 mM | |
13 | H2O | natural abundance | 95 % | |
14 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz 1.7-mm microcryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.5 mM [U-5% 13C; U-100% 15N] HR5531E, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | HR5531E | [U-5% 13C; U-100% 15N] | 0.50 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | DSS | natural abundance | 50 uM | |
12 | DTT | natural abundance | 10 mM | |
13 | H2O | natural abundance | 95 % | |
14 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16681_2kt1.nef |
Input source #2: Coordindates | 2kt1.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80-------- MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGLNERTRQRGDFPGTYVEFLGPLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGLNERTRQRGDFPGTYVEFLGPLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 88 | 0 | 0 | 100.0 |
Content subtype: combined_16681_2kt1.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80-------- MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGLNERTRQRGDFPGTYVEFLGPLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGLNERTRQRGDFPGTYVEFLGPLE --------10--------20--------30--------40--------50--------60--------70--------80--
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
8 | GLN | CD | 178.82 |
39 | GLN | CD | 180.17 |
52 | GLN | CD | 181.15 |
64 | THR | HG1 | 5.972 |
66 | GLN | CD | 180.47 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 532 | 460 | 86.5 |
13C chemical shifts | 397 | 346 | 87.2 |
15N chemical shifts | 95 | 73 | 76.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 179 | 159 | 88.8 |
13C chemical shifts | 176 | 155 | 88.1 |
15N chemical shifts | 80 | 67 | 83.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 353 | 301 | 85.3 |
13C chemical shifts | 221 | 191 | 86.4 |
15N chemical shifts | 15 | 6 | 40.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 42 | 41 | 97.6 |
13C chemical shifts | 42 | 41 | 97.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 50 | 33 | 66.0 |
13C chemical shifts | 49 | 33 | 67.3 |
15N chemical shifts | 1 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80-------- MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGLNERTRQRGDFPGTYVEFLGPLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..GPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGLNERTRQRGDFPGTYVEFLGPL --------10--------20--------30--------40--------50--------60--------70--------80-
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80-------- MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGLNERTRQRGDFPGTYVEFLGPLEHHHHHH |||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||| ...PEGFQYRALYPFRR..PEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGLNERTRQRGDF.GTYVEFLGPLE --------10--------20--------30--------40--------50--------60--------70--------80--