Solution Structure of a putative disulphide-isomerase from Bacteroides thetaiotaomicron
MSLAQADGIA FRELSFPEAL KRAEVEDKLL FVDCFTTWCG PCKRLSKVVF KDSLVADYFN RHFVNLKMDM EKGEGVELRK KYGVHAYPTL LFINSSGEVV YRLVGAEDAP ELLKKVKLGV ESEGHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.4 % (1412 of 1545) | 91.4 % (732 of 801) | 91.5 % (561 of 613) | 90.8 % (119 of 131) |
Backbone | 91.7 % (708 of 772) | 92.1 % (244 of 265) | 91.9 % (350 of 381) | 90.5 % (114 of 126) |
Sidechain | 91.3 % (816 of 894) | 91.2 % (489 of 536) | 91.2 % (322 of 353) | 100.0 % (5 of 5) |
Aromatic | 85.9 % (134 of 156) | 87.2 % (68 of 78) | 84.4 % (65 of 77) | 100.0 % (1 of 1) |
Methyl | 97.2 % (140 of 144) | 97.2 % (70 of 72) | 97.2 % (70 of 72) |
1. putative disulphide-isomerase
MSLAQADGIA FRELSFPEAL KRAEVEDKLL FVDCFTTWCG PCKRLSKVVF KDSLVADYFN RHFVNLKMDM EKGEGVELRK KYGVHAYPTL LFINSSGEVV YRLVGAEDAP ELLKKVKLGV ESEGHHHHHHSolvent system 90% H2O, 10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.5, Details 20mM Na phosphate buffer, 150mM NaCl, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | putative disulphide-isomerase | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.5, Details 20mM Na phosphate buffer, 150mM NaCl, pD7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | putative disulphide-isomerase | [U-13C; U-15N] | 1 mM | |
7 | sodium chloride | natural abundance | 150 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.5, Details 20mM Na phosphate buffer, 150mM NaCl, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | putative disulphide-isomerase | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.5, Details 20mM Na phosphate buffer, 150mM NaCl, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | putative disulphide-isomerase | [U-13C; U-15N] | 1 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.5, Details 20mM Na phosphate buffer, 150mM NaCl, pD7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | putative disulphide-isomerase | [U-13C; U-15N] | 1 mM | |
7 | sodium chloride | natural abundance | 150 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | D2O | natural abundance | 100 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.5, Details 20mM Na phosphate buffer, 150mM NaCl, pD7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | putative disulphide-isomerase | [U-13C; U-15N] | 1 mM | |
7 | sodium chloride | natural abundance | 150 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | D2O | natural abundance | 100 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.5, Details 20mM Na phosphate buffer, 150mM NaCl, pD7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | putative disulphide-isomerase | [U-13C; U-15N] | 1 mM | |
7 | sodium chloride | natural abundance | 150 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | D2O | natural abundance | 100 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.5, Details 20mM Na phosphate buffer, 150mM NaCl, pD7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | putative disulphide-isomerase | [U-13C; U-15N] | 1 mM | |
7 | sodium chloride | natural abundance | 150 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16731_2kuc.nef |
Input source #2: Coordindates | 2kuc.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- MSLAQADGIAFRELSFPEALKRAEVEDKLLFVDCFTTWCGPCKRLSKVVFKDSLVADYFNRHFVNLKMDMEKGEGVELRKKYGVHAYPTLLFINSSGEVV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSLAQADGIAFRELSFPEALKRAEVEDKLLFVDCFTTWCGPCKRLSKVVFKDSLVADYFNRHFVNLKMDMEKGEGVELRKKYGVHAYPTLLFINSSGEVV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 100-------110-------120------- YRLVGAEDAPELLKKVKLGVESEGHHHHHH |||||||||||||||||||||||||||||| YRLVGAEDAPELLKKVKLGVESEGHHHHHH -------110-------120-------130
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 130 | 0 | 0 | 100.0 |
Content subtype: combined_16731_2kuc.nef
Assigned chemical shifts
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- MSLAQADGIAFRELSFPEALKRAEVEDKLLFVDCFTTWCGPCKRLSKVVFKDSLVADYFNRHFVNLKMDMEKGEGVELRKKYGVHAYPTLLFINSSGEVV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...AQADGIAFRELSFPEALKRAEVEDKLLFVDCFTTWCGPCKRLSKVVFKDSLVADYFNRHFVNLKMDMEKGEGVELRKKYGVHAYPTLLFINSSGEVV -----------10--------20--------30--------40--------50--------60--------70--------80--------90------- 100-------110-------120------- YRLVGAEDAPELLKKVKLGVESEGHHHHHH |||||||||||||||||||||||| YRLVGAEDAPELLKKVKLGVESEG 100-------110-------120-
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
86 | THR | HG1 | 5.49 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 801 | 734 | 91.6 |
13C chemical shifts | 613 | 565 | 92.2 |
15N chemical shifts | 137 | 117 | 85.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 265 | 242 | 91.3 |
13C chemical shifts | 260 | 240 | 92.3 |
15N chemical shifts | 126 | 112 | 88.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 536 | 492 | 91.8 |
13C chemical shifts | 353 | 325 | 92.1 |
15N chemical shifts | 11 | 5 | 45.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 75 | 72 | 96.0 |
13C chemical shifts | 75 | 72 | 96.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 78 | 66 | 84.6 |
13C chemical shifts | 77 | 65 | 84.4 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- MSLAQADGIAFRELSFPEALKRAEVEDKLLFVDCFTTWCGPCKRLSKVVFKDSLVADYFNRHFVNLKMDMEKGEGVELRKKYGVHAYPTLLFINSSGEVV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....QADGIAFRELSFPEALKRAEVEDKLLFVDCFTTWCGPCKRLSKVVFKDSLVADYFNRHFVNLKMDMEKGEGVELRKKYGVHAYPTLLFINSSGEVV -----------10--------20--------30--------40--------50--------60--------70--------80--------90------- 100-------110-------120------- YRLVGAEDAPELLKKVKLGVESEGHHHHHH |||||||||||||||||||||||| YRLVGAEDAPELLKKVKLGVESEG 100-------110-------120-
Dihedral angle restraints
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- MSLAQADGIAFRELSFPEALKRAEVEDKLLFVDCFTTWCGPCKRLSKVVFKDSLVADYFNRHFVNLKMDMEKGEGVELRKKYGVHAYPTLLFINSSGEVV |||||||||||||||||||| |||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | .......GIAFRELSFPEALKRAEVED.LLFVDCFTTW.GPCKRLSKVVFKDSLVADYFNRHFVNLKMDMEKGEGVELRKKYGVHAYPTLLFINSSG..V -----------10--------20--------30--------40--------50--------60--------70--------80--------90------- 100-------110-------120------- YRLVGAEDAPELLKKVKLGVESEGHHHHHH ||||||||||||||||||||| YRLVGAEDAPELLKKVKLGVE 100-------110--------