Mesencephalic astrocyte-derived neurotrophic factor (MANF)
GSLRPGDCEV CISYLGRFYQ DLKDRDVTFS PATIENELIK FCREARGKEN RLCYYIGATD DAATKIINEV SKPLAHHIPV EKICEKLKKK DSQICELKYD KQIDLSTVDL KKLRVKELKK ILDDWGETCK GCAEKSDYIR KINELMPKYA PKAASARTDL
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.1 % (1712 of 1922) | 95.1 % (960 of 1009) | 79.8 % (592 of 742) | 93.6 % (160 of 171) |
Backbone | 82.1 % (778 of 948) | 94.7 % (304 of 321) | 68.7 % (325 of 473) | 96.8 % (149 of 154) |
Sidechain | 95.5 % (1076 of 1127) | 94.8 % (652 of 688) | 98.1 % (414 of 422) | 58.8 % (10 of 17) |
Aromatic | 99.1 % (105 of 106) | 100.0 % (53 of 53) | 98.1 % (51 of 52) | 100.0 % (1 of 1) |
Methyl | 100.0 % (172 of 172) | 100.0 % (86 of 86) | 100.0 % (86 of 86) |
1. MANF
GSLRPGDCEV CISYLGRFYQ DLKDRDVTFS PATIENELIK FCREARGKEN RLCYYIGATD DAATKIINEV SKPLAHHIPV EKICEKLKKK DSQICELKYD KQIDLSTVDL KKLRVKELKK ILDDWGETCK GCAEKSDYIR KINELMPKYA PKAASARTDLSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MANF | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian Unity Inova - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MANF | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian Unity Inova - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MANF | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian Unity Inova - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MANF | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian Unity Inova - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MANF | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian Unity Inova - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MANF | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian Unity Inova - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MANF | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian Unity Inova - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MANF | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian Unity Inova - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MANF | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian Unity Inova - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MANF | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian Unity Inova - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MANF | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian Unity Inova - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MANF | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian Unity Inova - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MANF | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian Unity Inova - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MANF | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian Unity Inova - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MANF | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian Unity Inova - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MANF | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian Unity Inova - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MANF | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr16775_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSLRPGDCEVCISYLGRFYQDLKDRDVTFSPATIENELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELKYD ||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||| .SLRPGDC.VCISYLGRFYQDLKDRDVTFSPATIENELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQI.ELKYD -------110-------120-------130-------140-------150-------160 KQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| KQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
5 | PRO | N | 138.18 |
31 | PRO | N | 107.165 |
73 | PRO | N | 134.098 |
79 | PRO | N | 138.6 |
147 | PRO | N | 133.106 |
151 | PRO | N | 136.75 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1009 | 945 | 93.7 |
13C chemical shifts | 742 | 568 | 76.5 |
15N chemical shifts | 171 | 154 | 90.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 321 | 297 | 92.5 |
13C chemical shifts | 320 | 155 | 48.4 |
15N chemical shifts | 154 | 144 | 93.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 688 | 648 | 94.2 |
13C chemical shifts | 422 | 413 | 97.9 |
15N chemical shifts | 17 | 10 | 58.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 87 | 87 | 100.0 |
13C chemical shifts | 87 | 87 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 53 | 100.0 |
13C chemical shifts | 52 | 51 | 98.1 |
15N chemical shifts | 1 | 1 | 100.0 |