Solution NMR structure of Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803), Northeast Structural Genomics Consortium Target SgR171
MAEIQFSKGV AETVVPEVRL SKSKNGQSGM AKFYFLEPTI LAKESTDDIT GMYLIDDEGE IITREVKGKF INGRPTAIEA TVILNSQPEW DRFMRFMERY GAENGLGFSK SELEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.0 % (1326 of 1411) | 93.9 % (690 of 735) | 93.7 % (517 of 552) | 96.0 % (119 of 124) |
Backbone | 96.1 % (684 of 712) | 95.9 % (236 of 246) | 96.3 % (337 of 350) | 95.7 % (111 of 116) |
Sidechain | 92.6 % (749 of 809) | 92.8 % (454 of 489) | 92.0 % (287 of 312) | 100.0 % (8 of 8) |
Aromatic | 73.8 % (96 of 130) | 73.8 % (48 of 65) | 73.4 % (47 of 64) | 100.0 % (1 of 1) |
Methyl | 99.1 % (115 of 116) | 98.3 % (57 of 58) | 100.0 % (58 of 58) |
1. Photosystem II reaction center Psb28 protein
MAEIQFSKGV AETVVPEVRL SKSKNGQSGM AKFYFLEPTI LAKESTDDIT GMYLIDDEGE IITREVKGKF INGRPTAIEA TVILNSQPEW DRFMRFMERY GAENGLGFSK SELEHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-100% 13C; U-100% 15N] | 0.58 (±0.06) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.2) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-5% 13C; U-100% 15N] | 0.44 (±0.04) mM | |
10 | MES | natural abundance | 20 (±1.0) mM | |
11 | sodium chloride | natural abundance | 100 (±5.0) mM | |
12 | calcium chloride | natural abundance | 5 (±0.2) mM | |
13 | DTT | natural abundance | 10 (±0.5) mM | |
14 | sodium azide | natural abundance | 0.02 (±0.001) % | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-100% 13C; U-100% 15N] | 0.58 (±0.06) mM | |
18 | MES | natural abundance | 20 (±1.0) mM | |
19 | sodium chloride | natural abundance | 100 (±5.0) mM | |
20 | calcium chloride | natural abundance | 5 (±0.2) mM | |
21 | DTT | natural abundance | 10 (±0.5) mM | |
22 | sodium azide | natural abundance | 0.02 (±0.001) % | |
23 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-100% 13C; U-100% 15N] | 0.58 (±0.06) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.2) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-5% 13C; U-100% 15N] | 0.44 (±0.04) mM | |
10 | MES | natural abundance | 20 (±1.0) mM | |
11 | sodium chloride | natural abundance | 100 (±5.0) mM | |
12 | calcium chloride | natural abundance | 5 (±0.2) mM | |
13 | DTT | natural abundance | 10 (±0.5) mM | |
14 | sodium azide | natural abundance | 0.02 (±0.001) % | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-100% 13C; U-100% 15N] | 0.58 (±0.06) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.2) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-100% 13C; U-100% 15N] | 0.58 (±0.06) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.2) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-100% 13C; U-100% 15N] | 0.58 (±0.06) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.2) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-100% 13C; U-100% 15N] | 0.58 (±0.06) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.2) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-100% 13C; U-100% 15N] | 0.58 (±0.06) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.2) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-100% 13C; U-100% 15N] | 0.58 (±0.06) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.2) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-100% 13C; U-100% 15N] | 0.58 (±0.06) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.2) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-100% 13C; U-100% 15N] | 0.58 (±0.06) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.2) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-100% 13C; U-100% 15N] | 0.58 (±0.06) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.2) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-100% 13C; U-100% 15N] | 0.58 (±0.06) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.2) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-100% 13C; U-100% 15N] | 0.58 (±0.06) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.2) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-100% 13C; U-100% 15N] | 0.58 (±0.06) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.2) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-100% 13C; U-100% 15N] | 0.58 (±0.06) mM | |
18 | MES | natural abundance | 20 (±1.0) mM | |
19 | sodium chloride | natural abundance | 100 (±5.0) mM | |
20 | calcium chloride | natural abundance | 5 (±0.2) mM | |
21 | DTT | natural abundance | 10 (±0.5) mM | |
22 | sodium azide | natural abundance | 0.02 (±0.001) % | |
23 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-100% 13C; U-100% 15N] | 0.58 (±0.06) mM | |
18 | MES | natural abundance | 20 (±1.0) mM | |
19 | sodium chloride | natural abundance | 100 (±5.0) mM | |
20 | calcium chloride | natural abundance | 5 (±0.2) mM | |
21 | DTT | natural abundance | 10 (±0.5) mM | |
22 | sodium azide | natural abundance | 0.02 (±0.001) % | |
23 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-100% 13C; U-100% 15N] | 0.58 (±0.06) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.2) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-5% 13C; U-100% 15N] | 0.44 (±0.04) mM | |
10 | MES | natural abundance | 20 (±1.0) mM | |
11 | sodium chloride | natural abundance | 100 (±5.0) mM | |
12 | calcium chloride | natural abundance | 5 (±0.2) mM | |
13 | DTT | natural abundance | 10 (±0.5) mM | |
14 | sodium azide | natural abundance | 0.02 (±0.001) % | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-100% 13C; U-100% 15N] | 0.58 (±0.06) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.2) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-5% 13C; U-100% 15N] | 0.44 (±0.04) mM | |
10 | MES | natural abundance | 20 (±1.0) mM | |
11 | sodium chloride | natural abundance | 100 (±5.0) mM | |
12 | calcium chloride | natural abundance | 5 (±0.2) mM | |
13 | DTT | natural abundance | 10 (±0.5) mM | |
14 | sodium azide | natural abundance | 0.02 (±0.001) % | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803) | [U-100% 13C; U-100% 15N] | 0.58 (±0.06) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.2) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16782_2kvo.nef |
Input source #2: Coordindates | 2kvo.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAEIQFSKGVAETVVPEVRLSKSKNGQSGMAKFYFLEPTILAKESTDDITGMYLIDDEGEIITREVKGKFINGRPTAIEATVILNSQPEWDRFMRFMERY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAEIQFSKGVAETVVPEVRLSKSKNGQSGMAKFYFLEPTILAKESTDDITGMYLIDDEGEIITREVKGKFINGRPTAIEATVILNSQPEWDRFMRFMERY -------110-------120 GAENGLGFSKSELEHHHHHH |||||||||||||||||||| GAENGLGFSKSELEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 120 | 0 | 0 | 100.0 |
Content subtype: combined_16782_2kvo.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAEIQFSKGVAETVVPEVRLSKSKNGQSGMAKFYFLEPTILAKESTDDITGMYLIDDEGEIITREVKGKFINGRPTAIEATVILNSQPEWDRFMRFMERY ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AEIQFSKGVAETVVPEVRLSKSKNGQSGMAKFYFLEPTILAKESTDDITGMYLIDDEGEIITREVKGKFINGRPTAIEATVILNSQPEWDRFMRFMERY -------110-------120 GAENGLGFSKSELEHHHHHH ||||||||||||||| || GAENGLGFSKSELEH...HH
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
25 | ASN | CG | 177.3 |
27 | GLN | CD | 180.3 |
63 | THR | HG1 | 6.12 |
72 | ASN | CG | 177.8 |
81 | THR | HG1 | 6.12 |
85 | ASN | CG | 176.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 735 | 689 | 93.7 |
13C chemical shifts | 552 | 511 | 92.6 |
15N chemical shifts | 130 | 123 | 94.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 246 | 236 | 95.9 |
13C chemical shifts | 240 | 227 | 94.6 |
15N chemical shifts | 116 | 110 | 94.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 489 | 453 | 92.6 |
13C chemical shifts | 312 | 284 | 91.0 |
15N chemical shifts | 14 | 13 | 92.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 61 | 96.8 |
13C chemical shifts | 63 | 61 | 96.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 65 | 46 | 70.8 |
13C chemical shifts | 64 | 45 | 70.3 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAEIQFSKGVAETVVPEVRLSKSKNGQSGMAKFYFLEPTILAKESTDDITGMYLIDDEGEIITREVKGKFINGRPTAIEATVILNSQPEWDRFMRFMERY ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AEIQFSKGVAETVVPEVRLSKSKNGQSGMAKFYFLEPTILAKESTDDITGMYLIDDEGEIITREVKGKFINGRPTAIEATVILNSQPEWDRFMRFMERY -------110-------120 GAENGLGFSKSELEHHHHHH ||||||||||||||| || GAENGLGFSKSELEH...HH
Dihedral angle restraints