Solution NMR of Putative excisionase from Klebsiella pneumoniae, Northeast Structural Genomics Consortium Target Target KpR49
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.7 % (808 of 954) | 91.6 % (456 of 498) | 73.3 % (272 of 371) | 94.1 % (80 of 85) |
Backbone | 81.5 % (378 of 464) | 93.8 % (150 of 160) | 68.4 % (156 of 228) | 94.7 % (72 of 76) |
Sidechain | 88.6 % (498 of 562) | 90.5 % (306 of 338) | 85.6 % (184 of 215) | 88.9 % (8 of 9) |
Aromatic | 66.1 % (78 of 118) | 76.3 % (45 of 59) | 55.4 % (31 of 56) | 66.7 % (2 of 3) |
Methyl | 97.2 % (70 of 72) | 97.2 % (35 of 36) | 97.2 % (35 of 36) |
1. KpR49
MAQIIFNEEW MVEKALMVRT GLGARQIESY RQGAWIEGVH FKRVSPSGEK TLRGTTWYNY PEINKFIRDS LEHHHHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N]KpR49, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KpR49 | [U-100% 13C; U-100% 15N] | 0.7 mM |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM [U-5% 13C; U-100% 15N]KpR49, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | KpR49 | [U-10% 13C; U-100% 15N] | 0.8 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N]KpR49, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KpR49 | [U-100% 13C; U-100% 15N] | 0.7 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM [U-5% 13C; U-100% 15N]KpR49, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | KpR49 | [U-10% 13C; U-100% 15N] | 0.8 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N]KpR49, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KpR49 | [U-100% 13C; U-100% 15N] | 0.7 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N]KpR49, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KpR49 | [U-100% 13C; U-100% 15N] | 0.7 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N]KpR49, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KpR49 | [U-100% 13C; U-100% 15N] | 0.7 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N]KpR49, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KpR49 | [U-100% 13C; U-100% 15N] | 0.7 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N]KpR49, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KpR49 | [U-100% 13C; U-100% 15N] | 0.7 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16795_2kvv.nef |
Input source #2: Coordindates | 2kvv.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70-------- MAQIIFNEEWMVEKALMVRTGLGARQIESYRQGAWIEGVHFKRVSPSGEKTLRGTTWYNYPEINKFIRDSLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAQIIFNEEWMVEKALMVRTGLGARQIESYRQGAWIEGVHFKRVSPSGEKTLRGTTWYNYPEINKFIRDSLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 78 | 0 | 0 | 100.0 |
Content subtype: combined_16795_2kvv.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70-------- MAQIIFNEEWMVEKALMVRTGLGARQIESYRQGAWIEGVHFKRVSPSGEKTLRGTTWYNYPEINKFIRDSLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..QIIFNEEWMVEKALMVRTGLGARQIESYRQGAWIEGVHFKRVSPSGEKTLRGTTWYNYPEINKFIRDSLEHH --------10--------20--------30--------40--------50--------60--------70----
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
20 | THR | HG1 | 4.36 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 498 | 447 | 89.8 |
13C chemical shifts | 371 | 251 | 67.7 |
15N chemical shifts | 91 | 77 | 84.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 160 | 146 | 91.2 |
13C chemical shifts | 156 | 71 | 45.5 |
15N chemical shifts | 76 | 69 | 90.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 338 | 301 | 89.1 |
13C chemical shifts | 215 | 180 | 83.7 |
15N chemical shifts | 15 | 8 | 53.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 39 | 37 | 94.9 |
13C chemical shifts | 39 | 37 | 94.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 59 | 44 | 74.6 |
13C chemical shifts | 56 | 30 | 53.6 |
15N chemical shifts | 3 | 2 | 66.7 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70-------- MAQIIFNEEWMVEKALMVRTGLGARQIESYRQGAWIEGVHFKRVSPSGEKTLRGTTWYNYPEINKFIRDSLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..QIIFNEEWMVEKALMVRTGLGARQIESYRQGAWIEGVHFKRVSPSGEKTLRGTTWYNYPEINKFIRDSLEH --------10--------20--------30--------40--------50--------60--------70---
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70-------- MAQIIFNEEWMVEKALMVRTGLGARQIESYRQGAWIEGVHFKRVSPSGEKTLRGTTWYNYPEINKFIRDSLEHHHHHH ||||||||||||| |||||||||||||||| |||||| ||||||||||||||||||| ........EWMVEKALMVRTG.GARQIESYRQGAWIEG..FKRVSP.......GTTWYNYPEINKFIRDSLE --------10--------20--------30--------40--------50--------60--------70--