data-driven model of MED1:DNA complex
Polymer type: polypeptide(L) polydeoxyribonucleotide
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 49.2 % (492 of 999) | 43.6 % (271 of 622) | 51.8 % (156 of 301) | 85.5 % (65 of 76) |
Backbone | 58.5 % (309 of 528) | 46.1 % (125 of 271) | 63.2 % (122 of 193) | 96.9 % (62 of 64) |
Sidechain | 44.9 % (240 of 534) | 41.6 % (146 of 351) | 53.2 % (91 of 171) | 25.0 % (3 of 12) |
Aromatic | 22.6 % (24 of 106) | 17.8 % (13 of 73) | 31.3 % (10 of 32) | 100.0 % (1 of 1) |
Methyl | 56.7 % (34 of 60) | 54.5 % (18 of 33) | 59.3 % (16 of 27) |
1. MED1zf
KSFQCSNCSV TETIRWRNIR SKEGIQCNAC FIYQRKYNKT RPVTAVNKYQ KRKLKVQETN GVDSF3. DNA
CGGAAAAGTA TACTTTTCCGSolvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 40 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | protein | [U-100% 13C; U-100% 15N | 0.5 ~ 1.0 mM |
Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium chloride | natural abundance | 40 mM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | Pf1 phage | natural abundance | 6 mg | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % | |
13 | protein | [U-100% 13C; U-100% 15N | 0.5 ~ 1.0 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 40 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | protein | [U-100% 13C; U-100% 15N | 0.5 ~ 1.0 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 40 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | protein | [U-100% 13C; U-100% 15N | 0.5 ~ 1.0 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 40 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | protein | [U-100% 13C; U-100% 15N | 0.5 ~ 1.0 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 40 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | protein | [U-100% 13C; U-100% 15N | 0.5 ~ 1.0 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 40 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | protein | [U-100% 13C; U-100% 15N | 0.5 ~ 1.0 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 40 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | protein | [U-100% 13C; U-100% 15N | 0.5 ~ 1.0 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 40 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | protein | [U-100% 13C; U-100% 15N | 0.5 ~ 1.0 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 40 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | protein | [U-100% 13C; U-100% 15N | 0.5 ~ 1.0 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 40 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | protein | [U-100% 13C; U-100% 15N | 0.5 ~ 1.0 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 40 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | protein | [U-100% 13C; U-100% 15N | 0.5 ~ 1.0 mM |
Bruker DRX - 600 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium chloride | natural abundance | 40 mM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | Pf1 phage | natural abundance | 6 mg | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % | |
13 | protein | [U-100% 13C; U-100% 15N | 0.5 ~ 1.0 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_16812_2kae.nef |
Input source #2: Coordindates | 2kae.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:11:CYS:SG | 4:1:ZN:ZN | unknown | unknown | n/a |
1:14:CYS:SG | 4:1:ZN:ZN | unknown | unknown | n/a |
1:33:CYS:SG | 4:1:ZN:ZN | unknown | unknown | n/a |
1:36:CYS:SG | 4:1:ZN:ZN | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
D | 1 | ZN | ZINC ION | None |
Sequence alignments
----110-------120-------130-------140-------150-------160-------170---- GSHMNKKSFQCSNCSVTETIRWRNIRSKEGIQCNACFIYQRKYNKTRPVTAVNKYQKRKLKVQETNGVDSF ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMNKKSFQCSNCSVTETIRWRNIRSKEGIQCNACFIYQRKYNKTRPVTAVNKYQKRKLKVQETNGVDSF --------10--------20--------30--------40--------50--------60--------70-
--------10--------20 CGGAAAAGTATACTTTTCCG |||||||||||||||||||| CGGAAAAGTATACTTTTCCG
--------30--------40 CGGAAAAGTATACTTTTCCG |||||||||||||||||||| CGGAAAAGTATACTTTTCCG --------10--------20
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 71 | 0 | 0 | 100.0 |
B | C | 20 | 0 | 0 | 100.0 |
C | B | 20 | 0 | 0 | 100.0 |
Content subtype: combined_16812_2kae.nef
Assigned chemical shifts
----110-------120-------130-------140-------150-------160-------170---- GSHMNKKSFQCSNCSVTETIRWRNIRSKEGIQCNACFIYQRKYNKTRPVTAVNKYQKRKLKVQETNGVDSF ||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......KSFQCSNCS.TETIRWRNIRSKEGIQCNACFIYQRKYNKTRPVTAVNKYQKRKLKVQETNGVDSF
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 464 | 263 | 56.7 |
13C chemical shifts | 325 | 145 | 44.6 |
15N chemical shifts | 89 | 65 | 73.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 144 | 125 | 86.8 |
13C chemical shifts | 142 | 61 | 43.0 |
15N chemical shifts | 70 | 62 | 88.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 320 | 138 | 43.1 |
13C chemical shifts | 183 | 84 | 45.9 |
15N chemical shifts | 19 | 3 | 15.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 28 | 18 | 64.3 |
13C chemical shifts | 28 | 16 | 57.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 35 | 9 | 25.7 |
13C chemical shifts | 34 | 6 | 17.6 |
15N chemical shifts | 1 | 1 | 100.0 |
Covalent bonds
Distance restraints
----110-------120-------130-------140-------150-------160-------170---- GSHMNKKSFQCSNCSVTETIRWRNIRSKEGIQCNACFIYQRKYNKTRPVTAVNKYQKRKLKVQETNGVDSF ||||||| ||||||||||||||||||||||||||||||||||||||||||| || ........FQCSNCS.TETIRWRNIRSKEGIQCNACFIYQRKYNKTRPVTAVNKYQKRK.KV ----110-------120-------130-------140-------150-------160-----
--------10--------20 CGGAAAAGTATACTTTTCCG |||||||||||||||||||| CGGAAAAGTATACTTTTCCG
--------30--------40 CGGAAAAGTATACTTTTCCG |||||||||||||||||||| CGGAAAAGTATACTTTTCCG
Dihedral angle restraints
RDC restraints
----110-------120-------130-------140-------150-------160-------170---- GSHMNKKSFQCSNCSVTETIRWRNIRSKEGIQCNACFIYQRKYNKTRPVTAVNKYQKRKLKVQETNGVDSF |||| | |||||||||||||| |||||||| | | ||| |||| ||| | || .........QCSN.S.TETIRWRNIRSKEG.QCNACFIY.R.Y.KTR.VTAV..YQK..L.VQ ----110-------120-------130-------140-------150-------160------