Solution Structure of acyl carrier protein from Borrelia burgdorferi, Seattle Structural Genomics Center for Infectious Disease (SSGCID) consortium
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.4 % (918 of 983) | 96.5 % (495 of 513) | 87.7 % (335 of 382) | 100.0 % (88 of 88) |
Backbone | 98.8 % (494 of 500) | 98.8 % (168 of 170) | 98.4 % (244 of 248) | 100.0 % (82 of 82) |
Sidechain | 89.5 % (504 of 563) | 95.3 % (327 of 343) | 79.9 % (171 of 214) | 100.0 % (6 of 6) |
Aromatic | 50.0 % (33 of 66) | 100.0 % (33 of 33) | 0.0 % (0 of 33) | |
Methyl | 95.5 % (84 of 88) | 95.5 % (42 of 44) | 95.5 % (42 of 44) |
1. acyl carrier protein
GPGSMDNDEI FSKVRSIISE QLDKKEDEIT TDSRFVEDLN ADSLDIYELL YLLEEAFDDK IPENEANEFE TVGDVVNFIK KRKGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein (BobuA.00658.a) | [U-95% 13C; U-95% 15N] | 1.1 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | acyl carrier protein (BobuA.00658.a) | [U-95% 15N] | 1.1 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | acyl carrier protein (BobuA.00658.a) | natural abundance | 1.1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein (BobuA.00658.a) | [U-95% 13C; U-95% 15N] | 1.1 mM |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein (BobuA.00658.a) | [U-95% 13C; U-95% 15N] | 1.1 mM |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein (BobuA.00658.a) | [U-95% 13C; U-95% 15N] | 1.1 mM |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein (BobuA.00658.a) | [U-95% 13C; U-95% 15N] | 1.1 mM |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein (BobuA.00658.a) | [U-95% 13C; U-95% 15N] | 1.1 mM |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein (BobuA.00658.a) | [U-95% 13C; U-95% 15N] | 1.1 mM |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein (BobuA.00658.a) | [U-95% 13C; U-95% 15N] | 1.1 mM |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein (BobuA.00658.a) | [U-95% 13C; U-95% 15N] | 1.1 mM |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein (BobuA.00658.a) | [U-95% 13C; U-95% 15N] | 1.1 mM |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein (BobuA.00658.a) | [U-95% 13C; U-95% 15N] | 1.1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16856_2kwl.nef |
Input source #2: Coordindates | 2kwl.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80---- GPGSMDNDEIFSKVRSIISEQLDKKEDEITTDSRFVEDLNADSLDIYELLYLLEEAFDDKIPENEANEFETVGDVVNFIKKRKG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPGSMDNDEIFSKVRSIISEQLDKKEDEITTDSRFVEDLNADSLDIYELLYLLEEAFDDKIPENEANEFETVGDVVNFIKKRKG
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 84 | 0 | 0 | 100.0 |
Content subtype: combined_16856_2kwl.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80---- GPGSMDNDEIFSKVRSIISEQLDKKEDEITTDSRFVEDLNADSLDIYELLYLLEEAFDDKIPENEANEFETVGDVVNFIKKRKG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPGSMDNDEIFSKVRSIISEQLDKKEDEITTDSRFVEDLNADSLDIYELLYLLEEAFDDKIPENEANEFETVGDVVNFIKKRKG
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 513 | 496 | 96.7 |
13C chemical shifts | 382 | 335 | 87.7 |
15N chemical shifts | 91 | 90 | 98.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 170 | 169 | 99.4 |
13C chemical shifts | 168 | 164 | 97.6 |
15N chemical shifts | 82 | 81 | 98.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 343 | 327 | 95.3 |
13C chemical shifts | 214 | 171 | 79.9 |
15N chemical shifts | 9 | 9 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 45 | 43 | 95.6 |
13C chemical shifts | 45 | 43 | 95.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 33 | 33 | 100.0 |
13C chemical shifts | 33 | 0 | 0.0 |
Distance restraints
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80---- GPGSMDNDEIFSKVRSIISEQLDKKEDEITTDSRFVEDLNADSLDIYELLYLLEEAFDDKIPENEANEFETVGDVVNFIKKRKG ||| |||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||| |||||||||||||| .PGS...DEIFSKVRSIISEQLDKKEDEITTDSRFVEDL.ADSLDIYELLYLLEEAFDDKIPENEANE.ETVGDVVNFIKKRK --------10--------20--------30--------40--------50--------60--------70--------80---
--------10--------20--------30--------40--------50--------60--------70--------80---- GPGSMDNDEIFSKVRSIISEQLDKKEDEITTDSRFVEDLNADSLDIYELLYLLEEAFDDKIPENEANEFETVGDVVNFIKKRKG ||||||||||||||||||||||||||||||||||||| |||||||||||||| ||||| ||| |||||| |||||||||| ...SMDNDEIFSKVRSIISEQLDKKEDEITTDSRFVEDLN.DSLDIYELLYLLEE.FDDKI.ENE.NEFETV.DVVNFIKKRK --------10--------20--------30--------40--------50--------60--------70--------80---