1H, 13C and 15N Chemical Shift assignments for RRM3 of Brunol-3.
GSHMQKEGPE GANLFIYHLP QEFGDQDILQ MFMPFGNVIS AKVFIDKQTN LSKCFGFVSY DNPVSAQAAI QAMNGFQIGM KRLKVQLKRS KNDSKPY
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.9 % (1021 of 1175) | 82.7 % (512 of 619) | 89.5 % (402 of 449) | 100.0 % (107 of 107) |
Backbone | 99.7 % (570 of 572) | 99.0 % (195 of 197) | 100.0 % (283 of 283) | 100.0 % (92 of 92) |
Sidechain | 78.0 % (540 of 692) | 75.1 % (317 of 422) | 81.6 % (208 of 255) | 100.0 % (15 of 15) |
Aromatic | 46.4 % (52 of 112) | 46.4 % (26 of 56) | 46.4 % (26 of 56) | |
Methyl | 85.4 % (70 of 82) | 85.4 % (35 of 41) | 85.4 % (35 of 41) |
1. RRM3
GSHMQKEGPE GANLFIYHLP QEFGDQDILQ MFMPFGNVIS AKVFIDKQTN LSKCFGFVSY DNPVSAQAAI QAMNGFQIGM KRLKVQLKRS KNDSKPYSolvent system 95% H2O/5% D2O, Temperature 308 (±0.01) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BRUNOL-3 | [U-13C; U-15N] | 1.0 ~ 1.2 (±0.05) mM | |
2 | sodium phosphate | natural abundance | 20 (±0.5) mM | |
3 | sodium chloride | natural abundance | 50 (±0.5) mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | D2O | natural abundance | 95 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 308 (±0.01) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BRUNOL-3 | [U-13C; U-15N] | 1.0 ~ 1.2 (±0.05) mM | |
2 | sodium phosphate | natural abundance | 20 (±0.5) mM | |
3 | sodium chloride | natural abundance | 50 (±0.5) mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | D2O | natural abundance | 95 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 308 (±0.01) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BRUNOL-3 | [U-13C; U-15N] | 1.0 ~ 1.2 (±0.05) mM | |
2 | sodium phosphate | natural abundance | 20 (±0.5) mM | |
3 | sodium chloride | natural abundance | 50 (±0.5) mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | D2O | natural abundance | 95 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 308 (±0.01) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BRUNOL-3 | [U-13C; U-15N] | 1.0 ~ 1.2 (±0.05) mM | |
2 | sodium phosphate | natural abundance | 20 (±0.5) mM | |
3 | sodium chloride | natural abundance | 50 (±0.5) mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | D2O | natural abundance | 95 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 308 (±0.01) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BRUNOL-3 | [U-13C; U-15N] | 1.0 ~ 1.2 (±0.05) mM | |
2 | sodium phosphate | natural abundance | 20 (±0.5) mM | |
3 | sodium chloride | natural abundance | 50 (±0.5) mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | D2O | natural abundance | 95 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 308 (±0.01) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BRUNOL-3 | [U-13C; U-15N] | 1.0 ~ 1.2 (±0.05) mM | |
2 | sodium phosphate | natural abundance | 20 (±0.5) mM | |
3 | sodium chloride | natural abundance | 50 (±0.5) mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | D2O | natural abundance | 95 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 308 (±0.01) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BRUNOL-3 | [U-13C; U-15N] | 1.0 ~ 1.2 (±0.05) mM | |
2 | sodium phosphate | natural abundance | 20 (±0.5) mM | |
3 | sodium chloride | natural abundance | 50 (±0.5) mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | D2O | natural abundance | 95 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 308 (±0.01) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BRUNOL-3 | [U-13C; U-15N] | 1.0 ~ 1.2 (±0.05) mM | |
2 | sodium phosphate | natural abundance | 20 (±0.5) mM | |
3 | sodium chloride | natural abundance | 50 (±0.5) mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | D2O | natural abundance | 95 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 308 (±0.01) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BRUNOL-3 | [U-13C; U-15N] | 1.0 ~ 1.2 (±0.05) mM | |
2 | sodium phosphate | natural abundance | 20 (±0.5) mM | |
3 | sodium chloride | natural abundance | 50 (±0.5) mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | D2O | natural abundance | 95 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 308 (±0.01) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BRUNOL-3 | [U-13C; U-15N] | 1.0 ~ 1.2 (±0.05) mM | |
2 | sodium phosphate | natural abundance | 20 (±0.5) mM | |
3 | sodium chloride | natural abundance | 50 (±0.5) mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | D2O | natural abundance | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 308 (±0.01) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BRUNOL-3 | [U-13C; U-15N] | 1.0 ~ 1.2 (±0.05) mM | |
2 | sodium phosphate | natural abundance | 20 (±0.5) mM | |
3 | sodium chloride | natural abundance | 50 (±0.5) mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | D2O | natural abundance | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 308 (±0.01) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BRUNOL-3 | [U-13C; U-15N] | 1.0 ~ 1.2 (±0.05) mM | |
2 | sodium phosphate | natural abundance | 20 (±0.5) mM | |
3 | sodium chloride | natural abundance | 50 (±0.5) mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | D2O | natural abundance | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 308 (±0.01) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BRUNOL-3 | [U-13C; U-15N] | 1.0 ~ 1.2 (±0.05) mM | |
2 | sodium phosphate | natural abundance | 20 (±0.5) mM | |
3 | sodium chloride | natural abundance | 50 (±0.5) mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | D2O | natural abundance | 95 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 308 (±0.01) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BRUNOL-3 | [U-13C; U-15N] | 1.0 ~ 1.2 (±0.05) mM | |
2 | sodium phosphate | natural abundance | 20 (±0.5) mM | |
3 | sodium chloride | natural abundance | 50 (±0.5) mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | D2O | natural abundance | 95 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16884_2my8.nef |
Input source #2: Coordindates | 2my8.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
----400-------410-------420-------430-------440-------450-------460-------470-------480-------490 GSHMQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY --------10--------20--------30--------40--------50--------60--------70--------80--------90-------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 97 | 0 | 0 | 100.0 |
Content subtype: combined_16884_2my8.nef
Assigned chemical shifts
----400-------410-------420-------430-------440-------450-------460-------470-------480-------490 GSHMQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 619 | 491 | 79.3 |
13C chemical shifts | 449 | 395 | 88.0 |
15N chemical shifts | 109 | 107 | 98.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 197 | 194 | 98.5 |
13C chemical shifts | 194 | 194 | 100.0 |
15N chemical shifts | 92 | 92 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 422 | 297 | 70.4 |
13C chemical shifts | 255 | 201 | 78.8 |
15N chemical shifts | 17 | 15 | 88.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 46 | 35 | 76.1 |
13C chemical shifts | 46 | 34 | 73.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 23 | 41.1 |
13C chemical shifts | 56 | 23 | 41.1 |
Distance restraints
----400-------410-------420-------430-------440-------450-------460-------470-------480-------490 GSHMQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY
Dihedral angle restraints
----400-------410-------420-------430-------440-------450-------460-------470-------480-------490 GSHMQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...........ANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKR ----400-------410-------420-------430-------440-------450-------460-------470-------480--