Delta subunit of RNA polymerase from Bacillus subtilis
GIKQYSQEEL KEMALVEIAH ELFEEHKKPV PFQELLNEIA SLLGVKKEEL GDRIAQFYTD LNIDGRFLAL SDQTWGLRSW YPYDQLDEET QPTVKAKKKK AKKAVEEDLD LDEFEEIDED DLDLDEVEEE LDLEADDFDE EDLDEDDDDL EIEEDIIDED DEDYDDEEEE IK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.2 % (1944 of 2021) | 95.4 % (1008 of 1057) | 96.6 % (758 of 785) | 99.4 % (178 of 179) |
Backbone | 99.1 % (1015 of 1024) | 97.7 % (337 of 345) | 99.8 % (510 of 511) | 100.0 % (168 of 168) |
Sidechain | 94.2 % (1096 of 1164) | 94.2 % (671 of 712) | 94.1 % (415 of 441) | 90.9 % (10 of 11) |
Aromatic | 72.7 % (96 of 132) | 75.8 % (50 of 66) | 68.8 % (44 of 64) | 100.0 % (2 of 2) |
Methyl | 99.4 % (173 of 174) | 98.9 % (86 of 87) | 100.0 % (87 of 87) |
1. delta
GIKQYSQEEL KEMALVEIAH ELFEEHKKPV PFQELLNEIA SLLGVKKEEL GDRIAQFYTD LNIDGRFLAL SDQTWGLRSW YPYDQLDEET QPTVKAKKKK AKKAVEEDLD LDEFEEIDED DLDLDEVEEE LDLEADDFDE EDLDEDDDDL EIEEDIIDED DEDYDDEEEE IKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 301 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | delta | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 50 uM | |
5 | phosphate buffer | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | internal | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | internal | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | internal | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | internal | direct | 1.0 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 301 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | delta | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 50 uM | |
5 | phosphate buffer | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 301 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | delta | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 50 uM | |
5 | phosphate buffer | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 301 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | delta | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 50 uM | |
5 | phosphate buffer | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 301 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | delta | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 50 uM | |
5 | phosphate buffer | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 301 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | delta | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 50 uM | |
5 | phosphate buffer | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 301 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | delta | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 50 uM | |
5 | phosphate buffer | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 301 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | delta | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 50 uM | |
5 | phosphate buffer | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 301 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | delta | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 50 uM | |
5 | phosphate buffer | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 301 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | delta | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 50 uM | |
5 | phosphate buffer | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 301 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | delta | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 50 uM | |
5 | phosphate buffer | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 301 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | delta | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 50 uM | |
5 | phosphate buffer | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % |
Varian Uniform NMR System - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 301 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | delta | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 50 uM | |
5 | phosphate buffer | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % |
Varian Uniform NMR System - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 301 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | delta | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 50 uM | |
5 | phosphate buffer | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % |
Varian Uniform NMR System - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 301 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | delta | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 50 uM | |
5 | phosphate buffer | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % |
Varian Uniform NMR System - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 301 K, pH 6.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | delta | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 50 uM | |
5 | phosphate buffer | natural abundance | 20 mM | |
6 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16912_2m4k.nef |
Input source #2: Coordindates | 2m4k.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- GIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWYPYDQLDEETQPTVKAKKKK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWYPYDQLDEETQPTVKAKKKK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ------110-------120-------130-------140-------150-------160-------170--- AKKAVEEDLDLDEFEEIDEDDLDLDEVEEELDLEADDFDEEDLDEDDDDLEIEEDIIDEDDEDYDDEEEEIK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AKKAVEEDLDLDEFEEIDEDDLDLDEVEEELDLEADDFDEEDLDEDDDDLEIEEDIIDEDDEDYDDEEEEIK -------110-------120-------130-------140-------150-------160-------170--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 172 | 0 | 0 | 100.0 |
Content subtype: combined_16912_2m4k.nef
Assigned chemical shifts
-------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- GIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWYPYDQLDEETQPTVKAKKKK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWYPYDQLDEETQPTVKAKKKK ------110-------120-------130-------140-------150-------160-------170--- AKKAVEEDLDLDEFEEIDEDDLDLDEVEEELDLEADDFDEEDLDEDDDDLEIEEDIIDEDDEDYDDEEEEIK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AKKAVEEDLDLDEFEEIDEDDLDLDEVEEELDLEADDFDEEDLDEDDDDLEIEEDIIDEDDEDYDDEEEEIK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
30 | PRO | N | 134.105 |
32 | PRO | N | 136.108 |
83 | PRO | N | 136.054 |
93 | PRO | N | 136.912 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1057 | 1017 | 96.2 |
13C chemical shifts | 785 | 752 | 95.8 |
15N chemical shifts | 182 | 179 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 345 | 342 | 99.1 |
13C chemical shifts | 344 | 342 | 99.4 |
15N chemical shifts | 168 | 167 | 99.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 712 | 675 | 94.8 |
13C chemical shifts | 441 | 410 | 93.0 |
15N chemical shifts | 14 | 12 | 85.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 88 | 87 | 98.9 |
13C chemical shifts | 88 | 87 | 98.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 66 | 46 | 69.7 |
13C chemical shifts | 64 | 42 | 65.6 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
Dihedral angle restraints