Solution NMR structure of the PBS linker domain of phycobilisome linker polypeptide from Anabaena sp. Northeast Structural Genomics Consortium Target NsR123E
MKVFKRVAGI KDKAAIKTLI SAAYRQIFER DIAPYIAQNE FSGWESKLGN GEITVKEFIE GLGYSNLYLK EFYTPYPNTK VIELGTKHFL GRAPIDQAEI RKYNQILATQ GIRAFINALV NSQEYNEVFG EDTVPYRRFP TLEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.5 % (1699 of 1818) | 93.2 % (883 of 947) | 93.3 % (665 of 713) | 95.6 % (151 of 158) |
Backbone | 94.6 % (834 of 882) | 94.0 % (284 of 302) | 94.7 % (414 of 437) | 95.1 % (136 of 143) |
Sidechain | 92.7 % (997 of 1075) | 92.9 % (599 of 645) | 92.3 % (383 of 415) | 100.0 % (15 of 15) |
Aromatic | 80.2 % (162 of 202) | 83.2 % (84 of 101) | 77.0 % (77 of 100) | 100.0 % (1 of 1) |
Methyl | 99.4 % (163 of 164) | 98.8 % (81 of 82) | 100.0 % (82 of 82) |
1. PBS
MKVFKRVAGI KDKAAIKTLI SAAYRQIFER DIAPYIAQNE FSGWESKLGN GEITVKEFIE GLGYSNLYLK EFYTPYPNTK VIELGTKHFL GRAPIDQAEI RKYNQILATQ GIRAFINALV NSQEYNEVFG EDTVPYRRFP TLEHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | MES | natural abundance | 20 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | entity | [U-5% 13C; U-100% 15N] | 0.975 mM | |
11 | sodium chloride | natural abundance | 100 mM | |
12 | calcium chloride | natural abundance | 5 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | MES | natural abundance | 20 mM | |
15 | NaN3 | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Solvent system 82% H2O/18% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | entity | [U-5% 13C; U-100% 15N] | 0.664 mM | |
20 | sodium chloride | natural abundance | 100 mM | |
21 | calcium chloride | natural abundance | 5 mM | |
22 | DTT | natural abundance | 10 mM | |
23 | MES | natural abundance | 20 mM | |
24 | NaN3 | natural abundance | 0.02 % | |
25 | DSS | natural abundance | 50 uM | |
26 | poly ethylene glycol | natural abundance | 4 % | |
27 | H2O | natural abundance | 82 % | |
28 | D2O | natural abundance | 18 % |
Solvent system 83% H2O/17% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
29 | entity | [U-5% 13C; U-100% 15N] | 0.851 mM | |
30 | sodium chloride | natural abundance | 100 mM | |
31 | calcium chloride | natural abundance | 5 mM | |
32 | DTT | natural abundance | 10 mM | |
33 | MES | natural abundance | 20 mM | |
34 | NaN3 | natural abundance | 0.02 % | |
35 | DSS | natural abundance | 50 uM | |
36 | poly acrylamide gel | natural abundance | 7 % | |
37 | H2O | natural abundance | 83 % | |
38 | D2O | natural abundance | 17 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | MES | natural abundance | 20 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | MES | natural abundance | 20 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | MES | natural abundance | 20 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | entity | [U-5% 13C; U-100% 15N] | 0.975 mM | |
11 | sodium chloride | natural abundance | 100 mM | |
12 | calcium chloride | natural abundance | 5 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | MES | natural abundance | 20 mM | |
15 | NaN3 | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | MES | natural abundance | 20 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | MES | natural abundance | 20 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | MES | natural abundance | 20 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | MES | natural abundance | 20 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | MES | natural abundance | 20 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | MES | natural abundance | 20 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | MES | natural abundance | 20 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | MES | natural abundance | 20 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | MES | natural abundance | 20 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 82% H2O/18% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | entity | [U-5% 13C; U-100% 15N] | 0.664 mM | |
20 | sodium chloride | natural abundance | 100 mM | |
21 | calcium chloride | natural abundance | 5 mM | |
22 | DTT | natural abundance | 10 mM | |
23 | MES | natural abundance | 20 mM | |
24 | NaN3 | natural abundance | 0.02 % | |
25 | DSS | natural abundance | 50 uM | |
26 | poly ethylene glycol | natural abundance | 4 % | |
27 | H2O | natural abundance | 82 % | |
28 | D2O | natural abundance | 18 % |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 83% H2O/17% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
29 | entity | [U-5% 13C; U-100% 15N] | 0.851 mM | |
30 | sodium chloride | natural abundance | 100 mM | |
31 | calcium chloride | natural abundance | 5 mM | |
32 | DTT | natural abundance | 10 mM | |
33 | MES | natural abundance | 20 mM | |
34 | NaN3 | natural abundance | 0.02 % | |
35 | DSS | natural abundance | 50 uM | |
36 | poly acrylamide gel | natural abundance | 7 % | |
37 | H2O | natural abundance | 83 % | |
38 | D2O | natural abundance | 17 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | entity | [U-5% 13C; U-100% 15N] | 0.975 mM | |
11 | sodium chloride | natural abundance | 100 mM | |
12 | calcium chloride | natural abundance | 5 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | MES | natural abundance | 20 mM | |
15 | NaN3 | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_16934_2ky4.nef |
Input source #2: Coordindates | 2ky4.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MKVFKRVAGIKDKAAIKTLISAAYRQIFERDIAPYIAQNEFSGWESKLGNGEITVKEFIEGLGYSNLYLKEFYTPYPNTKVIELGTKHFLGRAPIDQAEI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MKVFKRVAGIKDKAAIKTLISAAYRQIFERDIAPYIAQNEFSGWESKLGNGEITVKEFIEGLGYSNLYLKEFYTPYPNTKVIELGTKHFLGRAPIDQAEI -------110-------120-------130-------140--------- RKYNQILATQGIRAFINALVNSQEYNEVFGEDTVPYRRFPTLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||| RKYNQILATQGIRAFINALVNSQEYNEVFGEDTVPYRRFPTLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 149 | 0 | 0 | 100.0 |
Content subtype: combined_16934_2ky4.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MKVFKRVAGIKDKAAIKTLISAAYRQIFERDIAPYIAQNEFSGWESKLGNGEITVKEFIEGLGYSNLYLKEFYTPYPNTKVIELGTKHFLGRAPIDQAEI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MKVFKRVAGIKDKAAIKTLISAAYRQIFERDIAPYIAQNEFSGWESKLGNGEITVKEFIEGLGYSNLYLKEFYTPYPNTKVIELGTKHFLGRAPIDQAEI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140--------- RKYNQILATQGIRAFINALVNSQEYNEVFGEDTVPYRRFPTLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||| RKYNQILATQGIRAFINALVNSQEYNEVFGEDTVPYRRFPTLEH -------110-------120-------130-------140----
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
54 | THR | HG1 | 4.745 |
65 | SER | HG | 6.608 |
74 | THR | HG1 | 3.527 |
86 | THR | HG1 | 4.788 |
109 | THR | HG1 | 5.174 |
122 | SER | HG | 5.433 |
125 | TYR | HH | 9.057 |
138 | ARG | HH11 | 6.695 |
138 | ARG | HH12 | 6.695 |
138 | ARG | HH21 | 6.695 |
138 | ARG | HH22 | 6.695 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 947 | 901 | 95.1 |
13C chemical shifts | 713 | 671 | 94.1 |
15N chemical shifts | 166 | 156 | 94.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 302 | 289 | 95.7 |
13C chemical shifts | 298 | 286 | 96.0 |
15N chemical shifts | 143 | 135 | 94.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 645 | 612 | 94.9 |
13C chemical shifts | 415 | 385 | 92.8 |
15N chemical shifts | 23 | 21 | 91.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 83 | 83 | 100.0 |
13C chemical shifts | 83 | 83 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 101 | 84 | 83.2 |
13C chemical shifts | 100 | 77 | 77.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MKVFKRVAGIKDKAAIKTLISAAYRQIFERDIAPYIAQNEFSGWESKLGNGEITVKEFIEGLGYSNLYLKEFYTPYPNTKVIELGTKHFLGRAPIDQAEI ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .KVFKRVAGIKDKAAIKTLISAAYRQIFERDIAPYIAQNEFSGWESKLGNGEITVKEFIEGLGYSNLYLKEFYTPYPNTKVIELGTKHFLGRAPIDQAEI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140--------- RKYNQILATQGIRAFINALVNSQEYNEVFGEDTVPYRRFPTLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||| RKYNQILATQGIRAFINALVNSQEYNEVFGEDTVPYRRFPTLEH -------110-------120-------130-------140----
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MKVFKRVAGIKDKAAIKTLISAAYRQIFERDIAPYIAQNEFSGWESKLGNGEITVKEFIEGLGYSNLYLKEFYTPYPNTKVIELGTKHFLGRAPIDQAEI ||||||||||||||| |||||||||||||||||| ||||||||||||||||||| ||||||||||||| |||| ...........DKAAIKTLISAAYRQ.......PYIAQNEFSGWESKLGNG..TVKEFIEGLGYSNLYLKEF....PNTKVIELGTKHF.......QAEI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140--------- RKYNQILATQGIRAFINALVNSQEYNEVFGEDTVPYRRFPTLEHHHHHH ||||||||| |||||||||||||||||| RKYNQILAT..IRAFINALVNSQEYNEVF -------110-------120---------
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MKVFKRVAGIKDKAAIKTLISAAYRQIFERDIAPYIAQNEFSGWESKLGNGEITVKEFIEGLGYSNLYLKEFYTPYPNTKVIELGTKHFLGRAPIDQAEI ||||||||||||||| |||||||||||||||||| ||||||||||||||||||| ||||||||||||| |||| ...........DKAAIKTLISAAYRQ.......PYIAQNEFSGWESKLGNG..TVKEFIEGLGYSNLYLKEF....PNTKVIELGTKHF.......QAEI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140--------- RKYNQILATQGIRAFINALVNSQEYNEVFGEDTVPYRRFPTLEHHHHHH ||||||||| |||||||||||||||||| RKYNQILAT..IRAFINALVNSQEYNEVF -------110-------120---------
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MKVFKRVAGIKDKAAIKTLISAAYRQIFERDIAPYIAQNEFSGWESKLGNGEITVKEFIEGLGYSNLYLKEFYTPYPNTKVIELGTKHFLGRAPIDQAEI | |||| |||||| || || | | ||| | | ||| ||| || ||| || | | | ||| | |||| ||||||| | ||||| ..V..RVAG.KDKAAI.TL..AA.R...E.DIA....Q..F.GWE...GNG.IT.KEF.EG.G.S..Y.KEF.T...NTKV.ELGTKHF...A.IDQAE. --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140--------- RKYNQILATQGIRAFINALVNSQEYNEVFGEDTVPYRRFPTLEHHHHHH |||| || || | |||| | | || | RKYN.IL.TQ.I.AFIN.L...Q...EV.....V -------110-------120-------130----
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MKVFKRVAGIKDKAAIKTLISAAYRQIFERDIAPYIAQNEFSGWESKLGNGEITVKEFIEGLGYSNLYLKEFYTPYPNTKVIELGTKHFLGRAPIDQAEI | |||| |||||| || || | | ||| | | ||| ||| || ||| || | | | ||| | |||| ||||||| | ||||| ..V..RVAG.KDKAAI.TL..AA.R...E.DIA....Q..F.GWE...GNG.IT.KEF.EG.G.S..Y.KEF.T...NTKV.ELGTKHF...A.IDQAE. --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140--------- RKYNQILATQGIRAFINALVNSQEYNEVFGEDTVPYRRFPTLEHHHHHH |||| || || | |||| | | || | RKYN.IL.TQ.I.AFIN.L...Q...EV.....V -------110-------120-------130----