Solution structure of Enzyme IIB subunit of PTS system from Escherichia coli K12. Northeast Structural Genomics Consortium target ER315/Ontario Center for Structural Proteomics target ec0544
MSKKLIALCA CPMGLAHTFM AAQALEEAAV EAGYEVKIET QGADGIQNRL TAQDIAEATI IIHSVAVTPE DNERFESRDV YEITLQDAIK NAAGIIKEIE EMIASEQQ
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.1 % (1167 of 1202) | 97.1 % (600 of 618) | 96.4 % (451 of 468) | 100.0 % (116 of 116) |
Backbone | 98.6 % (635 of 644) | 98.2 % (215 of 219) | 98.4 % (314 of 319) | 100.0 % (106 of 106) |
Sidechain | 96.1 % (635 of 661) | 96.5 % (385 of 399) | 95.2 % (240 of 252) | 100.0 % (10 of 10) |
Aromatic | 72.7 % (32 of 44) | 90.9 % (20 of 22) | 54.5 % (12 of 22) | |
Methyl | 100.0 % (144 of 144) | 100.0 % (72 of 72) | 100.0 % (72 of 72) |
1. ec0544
MSKKLIALCA CPMGLAHTFM AAQALEEAAV EAGYEVKIET QGADGIQNRL TAQDIAEATI IIHSVAVTPE DNERFESRDV YEITLQDAIK NAAGIIKEIE EMIASEQQSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ec0544 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | zinc sulphate | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | benzamidine | natural abundance | 10 mM | |
7 | inhibitor cocktail | natural abundance | ||
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | ec0544 | [U-7% 13C; U-100% 15N] | 0.5 mM | |
11 | TRIS | [U-100% 2H] | 10 mM | |
12 | sodium chloride | natural abundance | 300 mM | |
13 | zinc sulphate | natural abundance | 10 uM | |
14 | DTT | [U-100% 2H] | 10 mM | |
15 | benzamidine | natural abundance | 10 mM | |
16 | inhibitor cocktail | natural abundance | 1 na | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ec0544 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | zinc sulphate | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | benzamidine | natural abundance | 10 mM | |
7 | inhibitor cocktail | natural abundance | ||
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ec0544 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | zinc sulphate | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | benzamidine | natural abundance | 10 mM | |
7 | inhibitor cocktail | natural abundance | ||
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ec0544 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | zinc sulphate | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | benzamidine | natural abundance | 10 mM | |
7 | inhibitor cocktail | natural abundance | ||
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ec0544 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | zinc sulphate | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | benzamidine | natural abundance | 10 mM | |
7 | inhibitor cocktail | natural abundance | ||
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ec0544 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | zinc sulphate | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | benzamidine | natural abundance | 10 mM | |
7 | inhibitor cocktail | natural abundance | ||
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ec0544 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | zinc sulphate | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | benzamidine | natural abundance | 10 mM | |
7 | inhibitor cocktail | natural abundance | ||
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ec0544 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | zinc sulphate | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | benzamidine | natural abundance | 10 mM | |
7 | inhibitor cocktail | natural abundance | ||
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ec0544 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | zinc sulphate | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | benzamidine | natural abundance | 10 mM | |
7 | inhibitor cocktail | natural abundance | ||
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ec0544 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | zinc sulphate | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | benzamidine | natural abundance | 10 mM | |
7 | inhibitor cocktail | natural abundance | ||
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | ec0544 | [U-7% 13C; U-100% 15N] | 0.5 mM | |
11 | TRIS | [U-100% 2H] | 10 mM | |
12 | sodium chloride | natural abundance | 300 mM | |
13 | zinc sulphate | natural abundance | 10 uM | |
14 | DTT | [U-100% 2H] | 10 mM | |
15 | benzamidine | natural abundance | 10 mM | |
16 | inhibitor cocktail | natural abundance | 1 na | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16979_2kyr.nef |
Input source #2: Coordindates | 2kyr.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- QGHMSKKLIALCACPMGLAHTFMAAQALEEAAVEAGYEVKIETQGADGIQNRLTAQDIAEATIIIHSVAVTPEDNERFESRDVYEITLQDAIKNAAGIIK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| QGHMSKKLIALCACPMGLAHTFMAAQALEEAAVEAGYEVKIETQGADGIQNRLTAQDIAEATIIIHSVAVTPEDNERFESRDVYEITLQDAIKNAAGIIK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 100-------- EIEEMIASEQQ ||||||||||| EIEEMIASEQQ -------110-
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 111 | 0 | 0 | 100.0 |
Content subtype: combined_16979_2kyr.nef
Assigned chemical shifts
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- QGHMSKKLIALCACPMGLAHTFMAAQALEEAAVEAGYEVKIETQGADGIQNRLTAQDIAEATIIIHSVAVTPEDNERFESRDVYEITLQDAIKNAAGIIK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...MSKKLIALCACPMGLAHTFMAAQALEEAAVEAGYEVKIETQGADGIQNRLTAQDIAEATIIIHSVAVTPEDNERFESRDVYEITLQDAIKNAAGIIK 100-------- EIEEMIASEQQ ||||||||||| EIEEMIASEQQ
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
18 | THR | HG1 | 5.113 |
51 | THR | HG1 | 5.194 |
59 | THR | HG1 | 5.104 |
84 | THR | HG1 | 5.081 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 635 | 610 | 96.1 |
13C chemical shifts | 479 | 452 | 94.4 |
15N chemical shifts | 123 | 115 | 93.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 226 | 218 | 96.5 |
13C chemical shifts | 222 | 212 | 95.5 |
15N chemical shifts | 109 | 105 | 96.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 409 | 392 | 95.8 |
13C chemical shifts | 257 | 240 | 93.4 |
15N chemical shifts | 14 | 10 | 71.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 76 | 74 | 97.4 |
13C chemical shifts | 76 | 74 | 97.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 24 | 20 | 83.3 |
13C chemical shifts | 24 | 12 | 50.0 |
Distance restraints
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- QGHMSKKLIALCACPMGLAHTFMAAQALEEAAVEAGYEVKIETQGADGIQNRLTAQDIAEATIIIHSVAVTPEDNERFESRDVYEITLQDAIKNAAGIIK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...MSKKLIALCACPMGLAHTFMAAQALEEAAVEAGYEVKIETQGADGIQNRLTAQDIAEATIIIHSVAVTPEDNERFESRDVYEITLQDAIKNAAGIIK 100-------- EIEEMIASEQQ ||||||||||| EIEEMIASEQQ
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- QGHMSKKLIALCACPMGLAHTFMAAQALEEAAVEAGYEVKIETQGADGIQNRLTAQDIAEATIIIHSVAVTPEDNERFESRDVYEITLQDAIKNAAGIIK |||||||| |||||||||||||||| | | |||| | | ||| ||| ||||||| | | || |||||||| .....KKLIALCA.....AHTFMAAQALEEAAVE...E.K.ETQG..G.Q...TAQ.IAE..IIIHSVA..............Y.I.LQ...KNAAGIIK -----------10--------20--------30--------40--------50--------60--------70--------80--------90------- 100-------- EIEEMIASEQQ ||||||||| EIEEMIASE 100------
Dihedral angle restraints
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- QGHMSKKLIALCACPMGLAHTFMAAQALEEAAVEAGYEVKIETQGADGIQNRLTAQDIAEATIIIHSVAVTPEDNERFESRDVYEITLQDAIKNAAGIIK |||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...MSKKLIALCACP.GLAHTFMAAQALEEAAVEAGYEVKIETQGADGIQNRLTAQDIAEATIIIHSVAVTPEDNERFESRDVYEITLQDAIKNAAGIIK 100-------- EIEEMIASEQQ ||||||||||| EIEEMIASEQQ