Solution NMR structure of the protein YP_510488.1
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.4 % (936 of 961) | 99.2 % (497 of 501) | 95.1 % (353 of 371) | 96.6 % (86 of 89) |
Backbone | 96.1 % (488 of 508) | 97.7 % (173 of 177) | 95.1 % (235 of 247) | 95.2 % (80 of 84) |
Sidechain | 97.5 % (517 of 530) | 99.1 % (321 of 324) | 95.0 % (191 of 201) | 100.0 % (5 of 5) |
Aromatic | 80.8 % (42 of 52) | 96.2 % (25 of 26) | 64.0 % (16 of 25) | 100.0 % (1 of 1) |
Methyl | 97.8 % (90 of 92) | 97.8 % (45 of 46) | 97.8 % (45 of 46) |
1. entity
GMQFKAEARR NKLMGLWVAE VLGKSGDEAN AYAAEVVKAD FEEAGHEDVM RKVLGDLDGK RPEAEVRAKY EGLMAVAKAQ LMDELSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details PC07345C, NaCl, Na2PO4, NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PC07345C | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 4.5 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details PC07345C, NaCl, Na2PO4, NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PC07345C | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 4.5 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details PC07345C, NaCl, Na2PO4, NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PC07345C | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 4.5 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details PC07345C, NaCl, Na2PO4, NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PC07345C | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 4.5 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details PC07345C, NaCl, Na2PO4, NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PC07345C | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 4.5 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details PC07345C, NaCl, Na2PO4, NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PC07345C | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 4.5 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details PC07345C, NaCl, Na2PO4, NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PC07345C | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 4.5 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details PC07345C, NaCl, Na2PO4, NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PC07345C | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 4.5 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details PC07345C, NaCl, Na2PO4, NaN3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PC07345C | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 4.5 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17002_2kzc.nef |
Input source #2: Coordindates | 2kzc.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80----- GMQFKAEARRNKLMGLWVAEVLGKSGDEANAYAAEVVKADFEEAGHEDVMRKVLGDLDGKRPEAEVRAKYEGLMAVAKAQLMDEL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GMQFKAEARRNKLMGLWVAEVLGKSGDEANAYAAEVVKADFEEAGHEDVMRKVLGDLDGKRPEAEVRAKYEGLMAVAKAQLMDEL
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 85 | 0 | 0 | 100.0 |
Content subtype: combined_17002_2kzc.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80----- GMQFKAEARRNKLMGLWVAEVLGKSGDEANAYAAEVVKADFEEAGHEDVMRKVLGDLDGKRPEAEVRAKYEGLMAVAKAQLMDEL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .MQFKAEARRNKLMGLWVAEVLGKSGDEANAYAAEVVKADFEEAGHEDVMRKVLGDLDGKRPEAEVRAKYEGLMAVAKAQLMDEL
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 501 | 493 | 98.4 |
13C chemical shifts | 371 | 352 | 94.9 |
15N chemical shifts | 94 | 90 | 95.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 177 | 171 | 96.6 |
13C chemical shifts | 170 | 160 | 94.1 |
15N chemical shifts | 84 | 80 | 95.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 324 | 322 | 99.4 |
13C chemical shifts | 201 | 192 | 95.5 |
15N chemical shifts | 10 | 10 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 51 | 51 | 100.0 |
13C chemical shifts | 51 | 51 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 26 | 25 | 96.2 |
13C chemical shifts | 25 | 16 | 64.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80----- GMQFKAEARRNKLMGLWVAEVLGKSGDEANAYAAEVVKADFEEAGHEDVMRKVLGDLDGKRPEAEVRAKYEGLMAVAKAQLMDEL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .MQFKAEARRNKLMGLWVAEVLGKSGDEANAYAAEVVKADFEEAGHEDVMRKVLGDLDGKRPEAEVRAKYEGLMAVAKAQLMDEL
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80----- GMQFKAEARRNKLMGLWVAEVLGKSGDEANAYAAEVVKADFEEAGHEDVMRKVLGDLDGKRPEAEVRAKYEGLMAVAKAQLMDEL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GMQFKAEARRNKLMGLWVAEVLGKSGDEANAYAAEVVKADFEEAGHEDVMRKVLGDLDGKRPEAEVRAKYEGLMAVAKAQLMDEL