Solution NMR Structure of Peptide methionine sulfoxide reductase msrB from Bacillus subtilis, Northeast Structural Genomics Consortium Target SR10
MAYNKEEKIK SLNRMQYEVT QNNGTEPPFQ NEYWDHKEEG LYVDIVSGKP LFTSKDKFDS QCGWPSFTKP IEEEVEEKLD TSHGMIRTEV RSRTADSHLG HVFNDGPGPN GLRYCINSAA LRFVPKHKLK EEGYESYLHL FNKLEHHHHH H
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 49.0 % (889 of 1814) | 29.3 % (279 of 953) | 66.9 % (470 of 703) | 88.6 % (140 of 158) |
Backbone | 78.3 % (697 of 890) | 49.7 % (151 of 304) | 93.7 % (415 of 443) | 91.6 % (131 of 143) |
Sidechain | 30.4 % (324 of 1065) | 19.7 % (128 of 649) | 46.6 % (187 of 401) | 60.0 % (9 of 15) |
Aromatic | 9.1 % (18 of 198) | 11.1 % (11 of 99) | 5.2 % (5 of 97) | 100.0 % (2 of 2) |
Methyl | 77.2 % (88 of 114) | 75.4 % (43 of 57) | 78.9 % (45 of 57) |
1. SR10
MAYNKEEKIK SLNRMQYEVT QNNGTEPPFQ NEYWDHKEEG LYVDIVSGKP LFTSKDKFDS QCGWPSFTKP IEEEVEEKLD TSHGMIRTEV RSRTADSHLG HVFNDGPGPN GLRYCINSAA LRFVPKHKLK EEGYESYLHL FNKLEHHHHH HSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-2H,13C,15N-selectively 1H Leu HD1,2;Val HG1,2;Ile HD1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR10 | [U-100% 13C; U-100% 15N; U-100% 2H] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | protease inhibitor | natural abundance | 1 na | |
7 | MES | natural abundance | 20 mM | |
8 | DSS | natural abundance | 50 uM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | SR10 | [U-5% 13C; U-100% 15N] | 1.2 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | sodium azide | natural abundance | 0.02 % | |
14 | calcium chloride | natural abundance | 5 mM | |
15 | sodium chloride | natural abundance | 100 mM | |
16 | protease inhibitor | natural abundance | 1 na | |
17 | MES | natural abundance | 20 mM | |
18 | DSS | natural abundance | 50 uM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Anisotropic sample containing phage
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | SR10 | [U-5% 13C; U-100% 15N] | 1.2 mM | |
22 | DTT | natural abundance | 10 mM | |
23 | sodium azide | natural abundance | 0.02 % | |
24 | calcium chloride | natural abundance | 5 mM | |
25 | sodium chloride | natural abundance | 200 mM | |
26 | protease inhibitor | natural abundance | 1 na | |
27 | MES | natural abundance | 20 mM | |
28 | DSS | natural abundance | 50 uM | |
29 | H2O | natural abundance | 90 % | |
30 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-2H,13C,15N-selectively 1H Leu HD1,2;Val HG1,2;Ile HD1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR10 | [U-100% 13C; U-100% 15N; U-100% 2H] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | protease inhibitor | natural abundance | 1 na | |
7 | MES | natural abundance | 20 mM | |
8 | DSS | natural abundance | 50 uM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-2H,13C,15N-selectively 1H Leu HD1,2;Val HG1,2;Ile HD1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR10 | [U-100% 13C; U-100% 15N; U-100% 2H] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | protease inhibitor | natural abundance | 1 na | |
7 | MES | natural abundance | 20 mM | |
8 | DSS | natural abundance | 50 uM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-2H,13C,15N-selectively 1H Leu HD1,2;Val HG1,2;Ile HD1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR10 | [U-100% 13C; U-100% 15N; U-100% 2H] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | protease inhibitor | natural abundance | 1 na | |
7 | MES | natural abundance | 20 mM | |
8 | DSS | natural abundance | 50 uM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-2H,13C,15N-selectively 1H Leu HD1,2;Val HG1,2;Ile HD1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR10 | [U-100% 13C; U-100% 15N; U-100% 2H] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | protease inhibitor | natural abundance | 1 na | |
7 | MES | natural abundance | 20 mM | |
8 | DSS | natural abundance | 50 uM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-2H,13C,15N-selectively 1H Leu HD1,2;Val HG1,2;Ile HD1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR10 | [U-100% 13C; U-100% 15N; U-100% 2H] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | protease inhibitor | natural abundance | 1 na | |
7 | MES | natural abundance | 20 mM | |
8 | DSS | natural abundance | 50 uM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-2H,13C,15N-selectively 1H Leu HD1,2;Val HG1,2;Ile HD1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR10 | [U-100% 13C; U-100% 15N; U-100% 2H] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | protease inhibitor | natural abundance | 1 na | |
7 | MES | natural abundance | 20 mM | |
8 | DSS | natural abundance | 50 uM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-2H,13C,15N-selectively 1H Leu HD1,2;Val HG1,2;Ile HD1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR10 | [U-100% 13C; U-100% 15N; U-100% 2H] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | protease inhibitor | natural abundance | 1 na | |
7 | MES | natural abundance | 20 mM | |
8 | DSS | natural abundance | 50 uM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-2H,13C,15N-selectively 1H Leu HD1,2;Val HG1,2;Ile HD1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR10 | [U-100% 13C; U-100% 15N; U-100% 2H] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | protease inhibitor | natural abundance | 1 na | |
7 | MES | natural abundance | 20 mM | |
8 | DSS | natural abundance | 50 uM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-2H,13C,15N-selectively 1H Leu HD1,2;Val HG1,2;Ile HD1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR10 | [U-100% 13C; U-100% 15N; U-100% 2H] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | protease inhibitor | natural abundance | 1 na | |
7 | MES | natural abundance | 20 mM | |
8 | DSS | natural abundance | 50 uM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-2H,13C,15N-selectively 1H Leu HD1,2;Val HG1,2;Ile HD1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR10 | [U-100% 13C; U-100% 15N; U-100% 2H] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | protease inhibitor | natural abundance | 1 na | |
7 | MES | natural abundance | 20 mM | |
8 | DSS | natural abundance | 50 uM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-2H,13C,15N-selectively 1H Leu HD1,2;Val HG1,2;Ile HD1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR10 | [U-100% 13C; U-100% 15N; U-100% 2H] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | protease inhibitor | natural abundance | 1 na | |
7 | MES | natural abundance | 20 mM | |
8 | DSS | natural abundance | 50 uM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-2H,13C,15N-selectively 1H Leu HD1,2;Val HG1,2;Ile HD1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR10 | [U-100% 13C; U-100% 15N; U-100% 2H] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | protease inhibitor | natural abundance | 1 na | |
7 | MES | natural abundance | 20 mM | |
8 | DSS | natural abundance | 50 uM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-2H,13C,15N-selectively 1H Leu HD1,2;Val HG1,2;Ile HD1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR10 | [U-100% 13C; U-100% 15N; U-100% 2H] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | protease inhibitor | natural abundance | 1 na | |
7 | MES | natural abundance | 20 mM | |
8 | DSS | natural abundance | 50 uM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details U-2H,13C,15N-selectively 1H Leu HD1,2;Val HG1,2;Ile HD1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR10 | [U-100% 13C; U-100% 15N; U-100% 2H] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | protease inhibitor | natural abundance | 1 na | |
7 | MES | natural abundance | 20 mM | |
8 | DSS | natural abundance | 50 uM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | SR10 | [U-5% 13C; U-100% 15N] | 1.2 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | sodium azide | natural abundance | 0.02 % | |
14 | calcium chloride | natural abundance | 5 mM | |
15 | sodium chloride | natural abundance | 100 mM | |
16 | protease inhibitor | natural abundance | 1 na | |
17 | MES | natural abundance | 20 mM | |
18 | DSS | natural abundance | 50 uM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Anisotropic sample containing phage
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | SR10 | [U-5% 13C; U-100% 15N] | 1.2 mM | |
22 | DTT | natural abundance | 10 mM | |
23 | sodium azide | natural abundance | 0.02 % | |
24 | calcium chloride | natural abundance | 5 mM | |
25 | sodium chloride | natural abundance | 200 mM | |
26 | protease inhibitor | natural abundance | 1 na | |
27 | MES | natural abundance | 20 mM | |
28 | DSS | natural abundance | 50 uM | |
29 | H2O | natural abundance | 90 % | |
30 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_17008_2kzn.nef |
Input source #2: Coordindates | 2kzn.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAYNKEEKIKSLNRMQYEVTQNNGTEPPFQNEYWDHKEEGLYVDIVSGKPLFTSKDKFDSQCGWPSFTKPIEEEVEEKLDTSHGMIRTEVRSRTADSHLG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAYNKEEKIKSLNRMQYEVTQNNGTEPPFQNEYWDHKEEGLYVDIVSGKPLFTSKDKFDSQCGWPSFTKPIEEEVEEKLDTSHGMIRTEVRSRTADSHLG -------110-------120-------130-------140-------150- HVFNDGPGPNGLRYCINSAALRFVPKHKLKEEGYESYLHLFNKLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||| HVFNDGPGPNGLRYCINSAALRFVPKHKLKEEGYESYLHLFNKLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 151 | 0 | 0 | 100.0 |
Content subtype: combined_17008_2kzn.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAYNKEEKIKSLNRMQYEVTQNNGTEPPFQNEYWDHKEEGLYVDIVSGKPLFTSKDKFDSQCGWPSFTKPIEEEVEEKLDTSHGMIRTEVRSRTADSHLG |||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..YNKEEKIKSLNRMQYEVTQNNGTE.PFQNEYWDHKEEGLYVDIVSGKPLFTSKDKFDSQCGWPSFTKPIEEEVEEKLDTSHGMIRTEVRSRTADSHLG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150- HVFNDGPGPNGLRYCINSAALRFVPKHKLKEEGYESYLHLFNKLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||| HVFNDGPGPNGLRYCINSAALRFVPKHKLKEEGYESYLHLFNKLE -------110-------120-------130-------140-----
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
35 | ASP | HD2 | 6.03 |
44 | ASP | HD2 | 5.247 |
47 | SER | HG | 6.016 |
54 | SER | HG | 5.068 |
56 | ASP | HD2 | 5.076 |
118 | SER | HG | 6.023 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 703 | 456 | 64.9 |
1H chemical shifts | 953 | 188 | 19.7 |
15N chemical shifts | 164 | 140 | 85.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 302 | 283 | 93.7 |
1H chemical shifts | 304 | 131 | 43.1 |
15N chemical shifts | 143 | 131 | 91.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 401 | 173 | 43.1 |
1H chemical shifts | 649 | 57 | 8.8 |
15N chemical shifts | 21 | 9 | 42.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 60 | 44 | 73.3 |
1H chemical shifts | 60 | 41 | 68.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 97 | 0 | 0.0 |
1H chemical shifts | 99 | 2 | 2.0 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAYNKEEKIKSLNRMQYEVTQNNGTEPPFQNEYWDHKEEGLYVDIVSGKPLFTSKDKFDSQCGWPSFTKPIEEEVEEKLDTSHGMIRTEVRSRTADSHLG |||||||||||||||||||||| ||||||||||||||||||||| ||||||| || ||| |||||||||||||||||||||| |||||| ....KEEKIKSLNRMQYEVTQNNGTE..FQNEYWDHKEEGLYVDIVSGK.LFTSKDK.....GW..FTK.IEEEVEEKLDTSHGMIRTEVRS..ADSHLG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150- HVFNDGPGPNGLRYCINSAALRFVPKHKLKEEGYESYLHLFNKLEHHHHHH |||||| | ||||||||||||||| |||||||||| || ||| || HVFNDG.G.NGLRYCINSAALRFV.KHKLKEEGYE.YL.LFN.LE -------110-------120-------130-------140-----
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAYNKEEKIKSLNRMQYEVTQNNGTEPPFQNEYWDHKEEGLYVDIVSGKPLFTSKDKFDSQCGWPSFTKPIEEEVEEKLDTSHGMIRTEVRSRTADSHLG |||||||||||||||||||||| ||||||||||||||||||||| ||||||| || ||| |||||||||||||||||||||| |||||| ....KEEKIKSLNRMQYEVTQNNGTE..FQNEYWDHKEEGLYVDIVSGK.LFTSKDK.....GW..FTK.IEEEVEEKLDTSHGMIRTEVRS..ADSHLG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150- HVFNDGPGPNGLRYCINSAALRFVPKHKLKEEGYESYLHLFNKLEHHHHHH |||||| | ||||||||||||||| |||||||||| || ||| || HVFNDG.G.NGLRYCINSAALRFV.KHKLKEEGYE.YL.LFN.LE -------110-------120-------130-------140-----
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAYNKEEKIKSLNRMQYEVTQNNGTEPPFQNEYWDHKEEGLYVDIVSGKPLFTSKDKFDSQCGWPSFTKPIEEEVEEKLDTSHGMIRTEVRSRTADSHLG ||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AYNKEEKIKSLNRMQYEVTQNNGTEPP.QNEYWDHKEEGLYVDIVSGKPLFTSKDKFDSQCGWPSFTKPIEEEVEEKLDTSHGMIRTEVRSRTADSHLG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150- HVFNDGPGPNGLRYCINSAALRFVPKHKLKEEGYESYLHLFNKLEHHHHHH |||||||||||||||||||||||||||||||||||||||||| HVFNDGPGPNGLRYCINSAALRFVPKHKLKEEGYESYLHLFN -------110-------120-------130-------140--
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAYNKEEKIKSLNRMQYEVTQNNGTEPPFQNEYWDHKEEGLYVDIVSGKPLFTSKDKFDSQCGWPSFTKPIEEEVEEKLDTSHGMIRTEVRSRTADSHLG ||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AYNKEEKIKSLNRMQYEVTQNNGTEPP.QNEYWDHKEEGLYVDIVSGKPLFTSKDKFDSQCGWPSFTKPIEEEVEEKLDTSHGMIRTEVRSRTADSHLG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150- HVFNDGPGPNGLRYCINSAALRFVPKHKLKEEGYESYLHLFNKLEHHHHHH |||||||||||||||||||||||||||||||||||||||||| HVFNDGPGPNGLRYCINSAALRFVPKHKLKEEGYESYLHLFN -------110-------120-------130-------140--
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAYNKEEKIKSLNRMQYEVTQNNGTEPPFQNEYWDHKEEGLYVDIVSGKPLFTSKDKFDSQCGWPSFTKPIEEEVEEKLDTSHGMIRTEVRSRTADSHLG |||||| | ||||||| | || ||| ||| ||| ||||| | || |||||||||| ||||||||| ||| ....KEEKIK.L.RMQYEVT.N..TE............EGL.VDI.SGK.LFTSK.K..........TK.IEEEVEEKLD......RTEVRSRTA..HLG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150- HVFNDGPGPNGLRYCINSAALRFVPKHKLKEEGYESYLHLFNKLEHHHHHH || || | ||| ||| || || || |||||||||| || .VF.DG.G.NGL..CIN..AL.FV.KH.LKEEGYESYL.LF -------110-------120-------130-------140-
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAYNKEEKIKSLNRMQYEVTQNNGTEPPFQNEYWDHKEEGLYVDIVSGKPLFTSKDKFDSQCGWPSFTKPIEEEVEEKLDTSHGMIRTEVRSRTADSHLG |||||| | ||||||| | || ||| ||| ||| ||||| | || |||||||||| ||||||||| ||| ....KEEKIK.L.RMQYEVT.N..TE............EGL.VDI.SGK.LFTSK.K..........TK.IEEEVEEKLD......RTEVRSRTA..HLG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150- HVFNDGPGPNGLRYCINSAALRFVPKHKLKEEGYESYLHLFNKLEHHHHHH || || | ||| ||| || || || |||||||||| || .VF.DG.G.NGL..CIN..AL.FV.KH.LKEEGYESYL.LF -------110-------120-------130-------140-