Backbone 1H,13C and 15N assignments of ChxR
HSVPESIRFG PNVFYVLKLT VETPEGSVHL TPSESGILKR LLINKGQLCL RKHLLEEIKN HAKAIVARNV DVHIASLRKK LGAYGSRIVT LRGVGYLFSD DGDKKFSQQD TKLSLE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.5 % (1164 of 1377) | 83.0 % (596 of 718) | 84.4 % (456 of 540) | 94.1 % (112 of 119) |
Backbone | 95.6 % (658 of 688) | 94.5 % (224 of 237) | 96.5 % (327 of 339) | 95.5 % (107 of 112) |
Sidechain | 76.6 % (610 of 796) | 77.3 % (372 of 481) | 75.6 % (233 of 308) | 71.4 % (5 of 7) |
Aromatic | 6.0 % (5 of 84) | 11.9 % (5 of 42) | 0.0 % (0 of 42) | |
Methyl | 90.8 % (138 of 152) | 89.5 % (68 of 76) | 92.1 % (70 of 76) |
1. ChxR effector domain
HSVPESIRFG PNVFYVLKLT VETPEGSVHL TPSESGILKR LLINKGQLCL RKHLLEEIKN HAKAIVARNV DVHIASLRKK LGAYGSRIVT LRGVGYLFSD DGDKKFSQQD TKLSLESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChxR effector domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 400 mM | |
3 | Na2HPO4 | natural abundance | 20 mM | |
4 | KH2PO4 | natural abundance | 20 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChxR effector domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 400 mM | |
3 | Na2HPO4 | natural abundance | 20 mM | |
4 | KH2PO4 | natural abundance | 20 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChxR effector domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 400 mM | |
3 | Na2HPO4 | natural abundance | 20 mM | |
4 | KH2PO4 | natural abundance | 20 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChxR effector domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 400 mM | |
3 | Na2HPO4 | natural abundance | 20 mM | |
4 | KH2PO4 | natural abundance | 20 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChxR effector domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 400 mM | |
3 | Na2HPO4 | natural abundance | 20 mM | |
4 | KH2PO4 | natural abundance | 20 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChxR effector domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 400 mM | |
3 | Na2HPO4 | natural abundance | 20 mM | |
4 | KH2PO4 | natural abundance | 20 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChxR effector domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 400 mM | |
3 | Na2HPO4 | natural abundance | 20 mM | |
4 | KH2PO4 | natural abundance | 20 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChxR effector domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 400 mM | |
3 | Na2HPO4 | natural abundance | 20 mM | |
4 | KH2PO4 | natural abundance | 20 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChxR effector domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 400 mM | |
3 | Na2HPO4 | natural abundance | 20 mM | |
4 | KH2PO4 | natural abundance | 20 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChxR effector domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 400 mM | |
3 | Na2HPO4 | natural abundance | 20 mM | |
4 | KH2PO4 | natural abundance | 20 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChxR effector domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | NaCl | natural abundance | 400 mM | |
3 | Na2HPO4 | natural abundance | 20 mM | |
4 | KH2PO4 | natural abundance | 20 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17014_2m1b.nef |
Input source #2: Coordindates | 2m1b.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 HSVPESIRFGPNVFYVLKLTVETPEGSVHLTPSESGILKRLLINKGQLCLRKHLLEEIKNHAKAIVARNVDVHIASLRKKLGAYGSRIVTLRGVGYLFSD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HSVPESIRFGPNVFYVLKLTVETPEGSVHLTPSESGILKRLLINKGQLCLRKHLLEEIKNHAKAIVARNVDVHIASLRKKLGAYGSRIVTLRGVGYLFSD -------110-------120-- DGDKKFSQQDTKLSLEHHHHHH |||||||||||||||||||||| DGDKKFSQQDTKLSLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 122 | 0 | 0 | 100.0 |
Content subtype: combined_17014_2m1b.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 HSVPESIRFGPNVFYVLKLTVETPEGSVHLTPSESGILKRLLINKGQLCLRKHLLEEIKNHAKAIVARNVDVHIASLRKKLGAYGSRIVTLRGVGYLFSD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||| .SVPESIRFGPNVFYVLKLTVETPEGSVHLTPSESGILKRLLINKGQLCLRKHLLEEIKNHAKAIVARNVDVHIASLRKKLGAYGSRIVTL.GVGYLFSD --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-- DGDKKFSQQDTKLSLEHHHHHH ||||||||||||||| DGDKKFSQQDTKLSL -------110-----
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 754 | 588 | 78.0 |
13C chemical shifts | 570 | 452 | 79.3 |
15N chemical shifts | 132 | 111 | 84.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 249 | 228 | 91.6 |
13C chemical shifts | 244 | 224 | 91.8 |
15N chemical shifts | 118 | 106 | 89.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 505 | 360 | 71.3 |
13C chemical shifts | 326 | 228 | 69.9 |
15N chemical shifts | 14 | 5 | 35.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 76 | 70 | 92.1 |
13C chemical shifts | 76 | 70 | 92.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 0 | 0.0 |
13C chemical shifts | 54 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 HSVPESIRFGPNVFYVLKLTVETPEGSVHLTPSESGILKRLLINKGQLCLRKHLLEEIKNHAKAIVARNVDVHIASLRKKLGAYGSRIVTLRGVGYLFSD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||| ..VPESIRFGPNVFYVLKLTVETPEGSVHLTPSESGILKRLLINKGQLCLRKHLLEEIKNHAKAIVARNVDVHIASLRKKLGAYGSRIVTL.GVGYLFSD --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-- DGDKKFSQQDTKLSLEHHHHHH ||||||||||||||| DGDKKFSQQDTKLSL -------110-----
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 HSVPESIRFGPNVFYVLKLTVETPEGSVHLTPSESGILKRLLINKGQLCLRKHLLEEIKNHAKAIVARNVDVHIASLRKKLGAYGSRIVTLRGVGYLFSD |||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||| ...PESIRFGPNVFYVLKLTVETPEGSVHLTPSESGILKRLLINKGQLCLRKHLLEEIK.......ARNVDVHIASLRKKLGAYGSRIVTLRGVGYLFSD --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-- DGDKKFSQQDTKLSLEHHHHHH ||||||||||||||| DGDKKFSQQDTKLSL -------110-----