Solution NMR structure of the protein YP_399305.1
MGITITDELL WAILKDELSD AEANALVWQA LGYVWDEAQS CWKTDLVAPE WRQDYPEPPD FIASRPATVK LTRSIPAPYK QLLKEELGFA GYSINELVPR KTRRATMTNW LLAYRRSQQD
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.1 % (1367 of 1438) | 96.8 % (724 of 748) | 92.0 % (518 of 563) | 98.4 % (125 of 127) |
Backbone | 94.7 % (667 of 704) | 95.8 % (226 of 236) | 93.0 % (331 of 356) | 98.2 % (110 of 112) |
Sidechain | 96.0 % (816 of 850) | 97.3 % (498 of 512) | 93.8 % (303 of 323) | 100.0 % (15 of 15) |
Aromatic | 86.4 % (114 of 132) | 98.5 % (65 of 66) | 71.7 % (43 of 60) | 100.0 % (6 of 6) |
Methyl | 96.5 % (137 of 142) | 95.8 % (68 of 71) | 97.2 % (69 of 71) |
1. entity
MGITITDELL WAILKDELSD AEANALVWQA LGYVWDEAQS CWKTDLVAPE WRQDYPEPPD FIASRPATVK LTRSIPAPYK QLLKEELGFA GYSINELVPR KTRRATMTNW LLAYRRSQQDSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.1 mM [U-98% 13C; U-98% 15N] YP_399305.1, 50 mM sodium chloride, 20 mM sodium phosphate, 4.5 mM sodium azide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_399305.1 | [U-98% 13C; U-98% 15N] | 1.1 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 4.5 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.1 mM [U-98% 13C; U-98% 15N] YP_399305.1, 50 mM sodium chloride, 20 mM sodium phosphate, 4.5 mM sodium azide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_399305.1 | [U-98% 13C; U-98% 15N] | 1.1 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 4.5 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.1 mM [U-98% 13C; U-98% 15N] YP_399305.1, 50 mM sodium chloride, 20 mM sodium phosphate, 4.5 mM sodium azide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_399305.1 | [U-98% 13C; U-98% 15N] | 1.1 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 4.5 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.1 mM [U-98% 13C; U-98% 15N] YP_399305.1, 50 mM sodium chloride, 20 mM sodium phosphate, 4.5 mM sodium azide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_399305.1 | [U-98% 13C; U-98% 15N] | 1.1 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 4.5 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.1 mM [U-98% 13C; U-98% 15N] YP_399305.1, 50 mM sodium chloride, 20 mM sodium phosphate, 4.5 mM sodium azide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_399305.1 | [U-98% 13C; U-98% 15N] | 1.1 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 4.5 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.1 mM [U-98% 13C; U-98% 15N] YP_399305.1, 50 mM sodium chloride, 20 mM sodium phosphate, 4.5 mM sodium azide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_399305.1 | [U-98% 13C; U-98% 15N] | 1.1 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 4.5 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.1 mM [U-98% 13C; U-98% 15N] YP_399305.1, 50 mM sodium chloride, 20 mM sodium phosphate, 4.5 mM sodium azide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_399305.1 | [U-98% 13C; U-98% 15N] | 1.1 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 4.5 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.1 mM [U-98% 13C; U-98% 15N] YP_399305.1, 50 mM sodium chloride, 20 mM sodium phosphate, 4.5 mM sodium azide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_399305.1 | [U-98% 13C; U-98% 15N] | 1.1 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 4.5 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.1 mM [U-98% 13C; U-98% 15N] YP_399305.1, 50 mM sodium chloride, 20 mM sodium phosphate, 4.5 mM sodium azide
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_399305.1 | [U-98% 13C; U-98% 15N] | 1.1 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | sodium phosphate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 4.5 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17090_2l1n.nef |
Input source #2: Coordindates | 2l1n.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGITITDELLWAILKDELSDAEANALVWQALGYVWDEAQSCWKTDLVAPEWRQDYPEPPDFIASRPATVKLTRSIPAPYKQLLKEELGFAGYSINELVPR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGITITDELLWAILKDELSDAEANALVWQALGYVWDEAQSCWKTDLVAPEWRQDYPEPPDFIASRPATVKLTRSIPAPYKQLLKEELGFAGYSINELVPR -------110-------120 KTRRATMTNWLLAYRRSQQD |||||||||||||||||||| KTRRATMTNWLLAYRRSQQD
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 120 | 0 | 0 | 100.0 |
Content subtype: combined_17090_2l1n.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGITITDELLWAILKDELSDAEANALVWQALGYVWDEAQSCWKTDLVAPEWRQDYPEPPDFIASRPATVKLTRSIPAPYKQLLKEELGFAGYSINELVPR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGITITDELLWAILKDELSDAEANALVWQALGYVWDEAQSCWKTDLVAPEWRQDYPEPPDFIASRPATVKLTRSIPAPYKQLLKEELGFAGYSINELVPR -------110-------120 KTRRATMTNWLLAYRRSQQD |||||||||||||||||||| KTRRATMTNWLLAYRRSQQD
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 748 | 740 | 98.9 |
13C chemical shifts | 563 | 513 | 91.1 |
15N chemical shifts | 135 | 130 | 96.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 236 | 234 | 99.2 |
13C chemical shifts | 240 | 211 | 87.9 |
15N chemical shifts | 112 | 110 | 98.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 512 | 506 | 98.8 |
13C chemical shifts | 323 | 302 | 93.5 |
15N chemical shifts | 23 | 20 | 87.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 73 | 73 | 100.0 |
13C chemical shifts | 73 | 70 | 95.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 66 | 65 | 98.5 |
13C chemical shifts | 60 | 43 | 71.7 |
15N chemical shifts | 6 | 6 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGITITDELLWAILKDELSDAEANALVWQALGYVWDEAQSCWKTDLVAPEWRQDYPEPPDFIASRPATVKLTRSIPAPYKQLLKEELGFAGYSINELVPR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGITITDELLWAILKDELSDAEANALVWQALGYVWDEAQSCWKTDLVAPEWRQDYPEPPDFIASRPATVKLTRSIPAPYKQLLKEELGFAGYSINELVPR -------110-------120 KTRRATMTNWLLAYRRSQQD |||||||||||||||||||| KTRRATMTNWLLAYRRSQQD
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGITITDELLWAILKDELSDAEANALVWQALGYVWDEAQSCWKTDLVAPEWRQDYPEPPDFIASRPATVKLTRSIPAPYKQLLKEELGFAGYSINELVPR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGITITDELLWAILKDELSDAEANALVWQALGYVWDEAQSCWKTDLVAPEWRQDYPEPPDFIASRPATVKLTRSIPAPYKQLLKEELGFAGYSINELVPR -------110-------120 KTRRATMTNWLLAYRRSQQD |||||||||||||||||||| KTRRATMTNWLLAYRRSQQD