YP_001336205.1
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.1 % (885 of 982) | 97.2 % (491 of 505) | 79.1 % (307 of 388) | 97.8 % (87 of 89) |
Backbone | 83.7 % (410 of 490) | 98.8 % (168 of 170) | 68.5 % (165 of 241) | 97.5 % (77 of 79) |
Sidechain | 96.8 % (549 of 567) | 96.4 % (323 of 335) | 97.3 % (216 of 222) | 100.0 % (10 of 10) |
Aromatic | 91.7 % (121 of 132) | 90.9 % (60 of 66) | 92.2 % (59 of 64) | 100.0 % (2 of 2) |
Methyl | 95.2 % (80 of 84) | 95.2 % (40 of 42) | 95.2 % (40 of 42) |
1. YP 001336205.1
GAAGIDQYAL KEFTADFTQF HIGDTVPAMY LTPEYNIKQW QQRNLPAPDA GSHWTYMGGN YVLITDTEGK ILKVYDGEIF YHRSolvent system 20 mM sodium phosphate buffer, 50 mM NaCl pH 6.0, 5% D2O, 0.03% of 3% NaN3, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_001336205.1 | [U-98% 13C; U-98% 15N] | 1.4 mM | |
2 | sodium phosphate buffer | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.005 mM | |
5 | D2O | [U-99% 2H] | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 20 mM sodium phosphate buffer, 50 mM NaCl pH 6.0, 5% D2O, 0.03% of 3% NaN3, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_001336205.1 | [U-98% 13C; U-98% 15N] | 1.4 mM | |
2 | sodium phosphate buffer | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.005 mM | |
5 | D2O | [U-99% 2H] | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 20 mM sodium phosphate buffer, 50 mM NaCl pH 6.0, 5% D2O, 0.03% of 3% NaN3, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_001336205.1 | [U-98% 13C; U-98% 15N] | 1.4 mM | |
2 | sodium phosphate buffer | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.005 mM | |
5 | D2O | [U-99% 2H] | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 20 mM sodium phosphate buffer, 50 mM NaCl pH 6.0, 5% D2O, 0.03% of 3% NaN3, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_001336205.1 | [U-98% 13C; U-98% 15N] | 1.4 mM | |
2 | sodium phosphate buffer | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.005 mM | |
5 | D2O | [U-99% 2H] | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 20 mM sodium phosphate buffer, 50 mM NaCl pH 6.0, 5% D2O, 0.03% of 3% NaN3, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_001336205.1 | [U-98% 13C; U-98% 15N] | 1.4 mM | |
2 | sodium phosphate buffer | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.005 mM | |
5 | D2O | [U-99% 2H] | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 20 mM sodium phosphate buffer, 50 mM NaCl pH 6.0, 5% D2O, 0.03% of 3% NaN3, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_001336205.1 | [U-98% 13C; U-98% 15N] | 1.4 mM | |
2 | sodium phosphate buffer | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.005 mM | |
5 | D2O | [U-99% 2H] | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 20 mM sodium phosphate buffer, 50 mM NaCl pH 6.0, 5% D2O, 0.03% of 3% NaN3, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_001336205.1 | [U-98% 13C; U-98% 15N] | 1.4 mM | |
2 | sodium phosphate buffer | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.005 mM | |
5 | D2O | [U-99% 2H] | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 20 mM sodium phosphate buffer, 50 mM NaCl pH 6.0, 5% D2O, 0.03% of 3% NaN3, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_001336205.1 | [U-98% 13C; U-98% 15N] | 1.4 mM | |
2 | sodium phosphate buffer | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.005 mM | |
5 | D2O | [U-99% 2H] | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_17104_2l1s.nef |
Input source #2: Coordindates | 2l1s.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--- GAAGIDQYALKEFTADFTQFHIGDTVPAMYLTPEYNIKQWQQRNLPAPDAGSHWTYMGGNYVLITDTEGKILKVYDGEIFYHR ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAAGIDQYALKEFTADFTQFHIGDTVPAMYLTPEYNIKQWQQRNLPAPDAGSHWTYMGGNYVLITDTEGKILKVYDGEIFYHR
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 83 | 0 | 0 | 100.0 |
Content subtype: combined_17104_2l1s.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--- GAAGIDQYALKEFTADFTQFHIGDTVPAMYLTPEYNIKQWQQRNLPAPDAGSHWTYMGGNYVLITDTEGKILKVYDGEIFYHR ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAAGIDQYALKEFTADFTQFHIGDTVPAMYLTPEYNIKQWQQRNLPAPDAGSHWTYMGGNYVLITDTEGKILKVYDGEIFYHR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 505 | 491 | 97.2 |
13C chemical shifts | 388 | 299 | 77.1 |
15N chemical shifts | 91 | 87 | 95.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 170 | 168 | 98.8 |
13C chemical shifts | 166 | 83 | 50.0 |
15N chemical shifts | 79 | 77 | 97.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 335 | 323 | 96.4 |
13C chemical shifts | 222 | 216 | 97.3 |
15N chemical shifts | 12 | 10 | 83.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 44 | 42 | 95.5 |
13C chemical shifts | 44 | 44 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 66 | 60 | 90.9 |
13C chemical shifts | 64 | 59 | 92.2 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--- GAAGIDQYALKEFTADFTQFHIGDTVPAMYLTPEYNIKQWQQRNLPAPDAGSHWTYMGGNYVLITDTEGKILKVYDGEIFYHR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AAGIDQYALKEFTADFTQFHIGDTVPAMYLTPEYNIKQWQQRNLPAPDAGSHWTYMGGNYVLITDTEGKILKVYDGEIFYHR