Solution Structure of the N-terminal Domain of NP_954075.1
GMSADGSEYG RYFEQLQKVN LTVRLGDTGS FDGTAAITSL KGSLAWLELF GAEQPPPNTL SEGAEVSVSV WTGGALCRCD GRVETLRDDR QFAIRLVGRV RELQRREYF
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.6 % (1098 of 1226) | 96.7 % (614 of 635) | 78.2 % (372 of 476) | 97.4 % (112 of 115) |
Backbone | 84.3 % (546 of 648) | 97.4 % (222 of 228) | 70.4 % (221 of 314) | 97.2 % (103 of 106) |
Sidechain | 96.0 % (647 of 674) | 96.3 % (392 of 407) | 95.3 % (246 of 258) | 100.0 % (9 of 9) |
Aromatic | 86.7 % (85 of 98) | 95.9 % (47 of 49) | 76.6 % (36 of 47) | 100.0 % (2 of 2) |
Methyl | 100.0 % (118 of 118) | 100.0 % (59 of 59) | 100.0 % (59 of 59) |
1. NP 954075.1
GMSADGSEYG RYFEQLQKVN LTVRLGDTGS FDGTAAITSL KGSLAWLELF GAEQPPPNTL SEGAEVSVSV WTGGALCRCD GRVETLRDDR QFAIRLVGRV RELQRREYFSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_954075.1 | [U-95% 13C; U-95% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | H2O | natural abundance | 95 % | |
5 | H2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_954075.1 | [U-95% 13C; U-95% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | H2O | natural abundance | 95 % | |
5 | H2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_954075.1 | [U-95% 13C; U-95% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | H2O | natural abundance | 95 % | |
5 | H2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_954075.1 | [U-95% 13C; U-95% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | H2O | natural abundance | 95 % | |
5 | H2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_954075.1 | [U-95% 13C; U-95% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | H2O | natural abundance | 95 % | |
5 | H2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_954075.1 | [U-95% 13C; U-95% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | H2O | natural abundance | 95 % | |
5 | H2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_954075.1 | [U-95% 13C; U-95% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | H2O | natural abundance | 95 % | |
5 | H2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_954075.1 | [U-95% 13C; U-95% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | H2O | natural abundance | 95 % | |
5 | H2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_17105_2l1t.nef |
Input source #2: Coordindates | 2l1t.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GMSADGSEYGRYFEQLQKVNLTVRLGDTGSFDGTAAITSLKGSLAWLELFGAEQPPPNTLSEGAEVSVSVWTGGALCRCDGRVETLRDDRQFAIRLVGRV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GMSADGSEYGRYFEQLQKVNLTVRLGDTGSFDGTAAITSLKGSLAWLELFGAEQPPPNTLSEGAEVSVSVWTGGALCRCDGRVETLRDDRQFAIRLVGRV --------- RELQRREYF ||||||||| RELQRREYF
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 109 | 0 | 0 | 100.0 |
Content subtype: combined_17105_2l1t.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GMSADGSEYGRYFEQLQKVNLTVRLGDTGSFDGTAAITSLKGSLAWLELFGAEQPPPNTLSEGAEVSVSVWTGGALCRCDGRVETLRDDRQFAIRLVGRV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .MSADGSEYGRYFEQLQKVNLTVRLGDTGSFDGTAAITSLKGSLAWLELFGAEQPPPNTLSEGAEVSVSVWTGGALCRCDGRVETLRDDRQFAIRLVGRV --------- RELQRREYF ||||||||| RELQRREYF
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 635 | 614 | 96.7 |
13C chemical shifts | 476 | 353 | 74.2 |
15N chemical shifts | 126 | 113 | 89.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 228 | 222 | 97.4 |
13C chemical shifts | 218 | 107 | 49.1 |
15N chemical shifts | 106 | 103 | 97.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 407 | 392 | 96.3 |
13C chemical shifts | 258 | 246 | 95.3 |
15N chemical shifts | 20 | 10 | 50.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 60 | 59 | 98.3 |
13C chemical shifts | 60 | 60 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 47 | 95.9 |
13C chemical shifts | 47 | 36 | 76.6 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GMSADGSEYGRYFEQLQKVNLTVRLGDTGSFDGTAAITSLKGSLAWLELFGAEQPPPNTLSEGAEVSVSVWTGGALCRCDGRVETLRDDRQFAIRLVGRV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..SADGSEYGRYFEQLQKVNLTVRLGDTGSFDGTAAITSLKGSLAWLELFGAEQPPPNTLSEGAEVSVSVWTGGALCRCDGRVETLRDDRQFAIRLVGRV --------- RELQRREYF ||||||||| RELQRREYF