Solution Structure of an Uncharacterized Thioredoin-like Protein from Clostridium perfringens
MSLEGIKQIN FQSINVVENL EEAKEGIPTI IMFKTDTCPY CVEMQKELSY VSKEREGKFN IYYARLEEEK NIDLAYKYDA NIVPTTVFLD KEGNKFYVHQ GLMRKNNIET ILNSLGVKEG HHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.8 % (1424 of 1534) | 93.0 % (746 of 802) | 92.4 % (550 of 595) | 93.4 % (128 of 137) |
Backbone | 92.4 % (693 of 750) | 91.4 % (234 of 256) | 93.0 % (345 of 371) | 92.7 % (114 of 123) |
Sidechain | 93.2 % (842 of 903) | 93.8 % (512 of 546) | 92.1 % (316 of 343) | 100.0 % (14 of 14) |
Aromatic | 77.6 % (104 of 134) | 80.6 % (54 of 67) | 74.6 % (50 of 67) | |
Methyl | 98.5 % (130 of 132) | 98.5 % (65 of 66) | 98.5 % (65 of 66) |
1. uncharacterized thiredoxin-like protein
MSLEGIKQIN FQSINVVENL EEAKEGIPTI IMFKTDTCPY CVEMQKELSY VSKEREGKFN IYYARLEEEK NIDLAYKYDA NIVPTTVFLD KEGNKFYVHQ GLMRKNNIET ILNSLGVKEG HHHHHHSolvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | uncharacterized thiredoxin-like protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pD6.4, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | uncharacterized thiredoxin-like protein | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | uncharacterized thiredoxin-like protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | uncharacterized thiredoxin-like protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pD6.4, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | uncharacterized thiredoxin-like protein | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pD6.4, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | uncharacterized thiredoxin-like protein | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pD6.4, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | uncharacterized thiredoxin-like protein | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pD6.4, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | uncharacterized thiredoxin-like protein | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | uncharacterized thiredoxin-like protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | uncharacterized thiredoxin-like protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | uncharacterized thiredoxin-like protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | uncharacterized thiredoxin-like protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | uncharacterized thiredoxin-like protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | uncharacterized thiredoxin-like protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17267_2l57.nef |
Input source #2: Coordindates | 2l57.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLEGIKQINFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEEEKNIDLAYKYDANIVPTTVFLDKEGNKFYVHQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSLEGIKQINFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEEEKNIDLAYKYDANIVPTTVFLDKEGNKFYVHQ -------110-------120------ GLMRKNNIETILNSLGVKEGHHHHHH |||||||||||||||||||||||||| GLMRKNNIETILNSLGVKEGHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 126 | 0 | 0 | 100.0 |
Content subtype: combined_17267_2l57.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLEGIKQINFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEEEKNIDLAYKYDANIVPTTVFLDKEGNKFYVHQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SLEGIKQINFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEEEKNIDLAYKYDANIVPTTVFLDKEGNKFYVHQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120------ GLMRKNNIETILNSLGVKEGHHHHHH |||||||||||||||||||| GLMRKNNIETILNSLGVKEG -------110-------120
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 802 | 753 | 93.9 |
13C chemical shifts | 595 | 552 | 92.8 |
15N chemical shifts | 140 | 129 | 92.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 256 | 239 | 93.4 |
13C chemical shifts | 252 | 236 | 93.7 |
15N chemical shifts | 123 | 113 | 91.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 546 | 514 | 94.1 |
13C chemical shifts | 343 | 316 | 92.1 |
15N chemical shifts | 17 | 16 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 70 | 69 | 98.6 |
13C chemical shifts | 70 | 69 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 67 | 53 | 79.1 |
13C chemical shifts | 67 | 49 | 73.1 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLEGIKQINFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEEEKNIDLAYKYDANIVPTTVFLDKEGNKFYVHQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..LEGIKQINFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEEEKNIDLAYKYDANIVPTTVFLDKEGNKFYVHQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120------ GLMRKNNIETILNSLGVKEGHHHHHH |||||||||||||||||||| GLMRKNNIETILNSLGVKEG -------110-------120
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLEGIKQINFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEEEKNIDLAYKYDANIVPTTVFLDKEGNKFYVHQ |||||||||| |||||||||| ||||||||||||||||||| ||||||||||||||||||||| |||||||||| ||||| ..............NVVENLEEAK..IPTIIMFKTD..PYCVEMQKELSYVSKEREG.FNIYYARLEEEKNIDLAYKYD..IVPTTVFLDK....FYVHQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120------ GLMRKNNIETILNSLGVKEGHHHHHH | ||||||||||||| G.MRKNNIETILNSL -------110-----