Solution Structure of Thioredoxin from Bacteroides Vulgatus
MSLATEGNGK VIHLTKAEFL AKVYNFEKNP EEWKYEGDKP AIVDFYADWC GPCKMVAPIL DELAKEYDGQ IVIYKVDTEK EQELAGAFGI RSIPSILFIP MEGKPEMAQG AMPKASFKKA IDEFLLKKEG HHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.2 % (1488 of 1632) | 89.9 % (767 of 853) | 92.7 % (596 of 643) | 91.9 % (125 of 136) |
Backbone | 91.1 % (729 of 800) | 88.3 % (242 of 274) | 93.0 % (370 of 398) | 91.4 % (117 of 128) |
Sidechain | 91.5 % (877 of 958) | 90.7 % (525 of 579) | 92.7 % (344 of 371) | 100.0 % (8 of 8) |
Aromatic | 79.6 % (129 of 162) | 77.8 % (63 of 81) | 81.0 % (64 of 79) | 100.0 % (2 of 2) |
Methyl | 98.5 % (130 of 132) | 97.0 % (64 of 66) | 100.0 % (66 of 66) |
1. thioredoxin
MSLATEGNGK VIHLTKAEFL AKVYNFEKNP EEWKYEGDKP AIVDFYADWC GPCKMVAPIL DELAKEYDGQ IVIYKVDTEK EQELAGAFGI RSIPSILFIP MEGKPEMAQG AMPKASFKKA IDEFLLKKEG HHHHHHSolvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pD6.4, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pD6.4, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pD6.4, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pD6.4, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pD6.4, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17275_2l5l.nef |
Input source #2: Coordindates | 2l5l.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLATEGNGKVIHLTKAEFLAKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSLATEGNGKVIHLTKAEFLAKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIP -------110-------120-------130------ MEGKPEMAQGAMPKASFKKAIDEFLLKKEGHHHHHH |||||||||||||||||||||||||||||||||||| MEGKPEMAQGAMPKASFKKAIDEFLLKKEGHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 136 | 0 | 0 | 100.0 |
Content subtype: combined_17275_2l5l.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLATEGNGKVIHLTKAEFLAKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIP ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SLATEGNGKVIHLTKAEFLAKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130------ MEGKPEMAQGAMPKASFKKAIDEFLLKKEGHHHHHH |||||||||||||||||||||||||||||| MEGKPEMAQGAMPKASFKKAIDEFLLKKEG -------110-------120-------130
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 853 | 800 | 93.8 |
13C chemical shifts | 643 | 602 | 93.6 |
15N chemical shifts | 137 | 124 | 90.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 274 | 255 | 93.1 |
13C chemical shifts | 272 | 255 | 93.8 |
15N chemical shifts | 128 | 116 | 90.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 579 | 545 | 94.1 |
13C chemical shifts | 371 | 347 | 93.5 |
15N chemical shifts | 9 | 8 | 88.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 71 | 70 | 98.6 |
13C chemical shifts | 71 | 70 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 81 | 68 | 84.0 |
13C chemical shifts | 79 | 66 | 83.5 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLATEGNGKVIHLTKAEFLAKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..LATEGNGKVIHLTKAEFLAKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130------ MEGKPEMAQGAMPKASFKKAIDEFLLKKEGHHHHHH |||||||||||||||||||||||||||||| MEGKPEMAQGAMPKASFKKAIDEFLLKKEG -------110-------120-------130
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLATEGNGKVIHLTKAEFLAKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIP | |||||||| || ||| |||||||| | ||| | ||| | || | |||||||||||||| ||| | || | | || || ....T.GNGKVIHL.KA.FLA.VYNFEKNP..W.YEG.K.AIV.F...WC..C..VAPILDELAKEYDG.IVI.K...EK...L...F.......IL.IP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130------ MEGKPEMAQGAMPKASFKKAIDEFLLKKEGHHHHHH ||| | ||| ||||||||||||| ..GKP....G.MPK.SFKKAIDEFLLKK -------110-------120--------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLATEGNGKVIHLTKAEFLAKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIP ||| ||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||| .SLA...NGKVIHLTKAEFLAKVYNFEKNPEEWKYE.DKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFG..SIPSILFIP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130------ MEGKPEMAQGAMPKASFKKAIDEFLLKKEGHHHHHH | ||||||||||||||||||||||||| M.GKPEMAQGAMPKASFKKAIDEFLLK -------110-------120-------