Solution Structure of a Putative Thioredoxin from Neisseria meningitidis
MSLDSKTAPA FSLPDLHGKT VSNADLQGKV TLINFWFPSC PGCVSEMPKI IKTANDYKNK NFQVLAVAQP IDPIESVRQY VKDYGLPFTV MYDADKAVGQ AFGTQVYPTS VLIGKKGEIL KTYVGEPDFG KLYQEIDTAW RNSDAEGHHH HHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.0 % (1661 of 1786) | 93.1 % (860 of 924) | 92.6 % (652 of 704) | 94.3 % (149 of 158) |
Backbone | 93.8 % (842 of 898) | 94.1 % (289 of 307) | 93.5 % (419 of 448) | 93.7 % (134 of 143) |
Sidechain | 92.4 % (952 of 1030) | 92.5 % (571 of 617) | 92.0 % (366 of 398) | 100.0 % (15 of 15) |
Aromatic | 81.5 % (145 of 178) | 82.0 % (73 of 89) | 80.5 % (70 of 87) | 100.0 % (2 of 2) |
Methyl | 97.5 % (156 of 160) | 97.5 % (78 of 80) | 97.5 % (78 of 80) |
1. putative thioredoxin
MSLDSKTAPA FSLPDLHGKT VSNADLQGKV TLINFWFPSC PGCVSEMPKI IKTANDYKNK NFQVLAVAQP IDPIESVRQY VKDYGLPFTV MYDADKAVGQ AFGTQVYPTS VLIGKKGEIL KTYVGEPDFG KLYQEIDTAW RNSDAEGHHH HHHSolvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 20mM Na phosphate buffer, 100mM NaCl, pH 7.0, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | putative thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H20 | natural abundance | 90 % | |
6 | D20 | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 20mM Na phosphate buffer, 100mM NaCl, pD6.6, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | putative thioredoxin | natural abundance | 1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D20 | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 20mM Na phosphate buffer, 100mM NaCl, pH 7.0, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | putative thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H20 | natural abundance | 90 % | |
6 | D20 | natural abundance | 10 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 20mM Na phosphate buffer, 100mM NaCl, pH 7.0, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | putative thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H20 | natural abundance | 90 % | |
6 | D20 | natural abundance | 10 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 20mM Na phosphate buffer, 100mM NaCl, pD6.6, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | putative thioredoxin | natural abundance | 1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D20 | natural abundance | 100 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 20mM Na phosphate buffer, 100mM NaCl, pD6.6, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | putative thioredoxin | natural abundance | 1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D20 | natural abundance | 100 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 20mM Na phosphate buffer, 100mM NaCl, pD6.6, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | putative thioredoxin | natural abundance | 1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D20 | natural abundance | 100 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 20mM Na phosphate buffer, 100mM NaCl, pD6.6, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | putative thioredoxin | natural abundance | 1 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D20 | natural abundance | 100 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 20mM Na phosphate buffer, 100mM NaCl, pH 7.0, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | putative thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H20 | natural abundance | 90 % | |
6 | D20 | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 20mM Na phosphate buffer, 100mM NaCl, pH 7.0, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | putative thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H20 | natural abundance | 90 % | |
6 | D20 | natural abundance | 10 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 20mM Na phosphate buffer, 100mM NaCl, pH 7.0, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | putative thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H20 | natural abundance | 90 % | |
6 | D20 | natural abundance | 10 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 20mM Na phosphate buffer, 100mM NaCl, pH 7.0, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | putative thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H20 | natural abundance | 90 % | |
6 | D20 | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 20mM Na phosphate buffer, 100mM NaCl, pH 7.0, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | putative thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H20 | natural abundance | 90 % | |
6 | D20 | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 20mM Na phosphate buffer, 100mM NaCl, pH 7.0, 1mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | putative thioredoxin | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H20 | natural abundance | 90 % | |
6 | D20 | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17277_2l5o.nef |
Input source #2: Coordindates | 2l5o.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- MSLDSKTAPAFSLPDLHGKTVSNADLQGKVTLINFWFPSCPGCVSEMPKIIKTANDYKNKNFQVLAVAQPIDPIESVRQYVKDYGLPFTVMYDADKAVGQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSLDSKTAPAFSLPDLHGKTVSNADLQGKVTLINFWFPSCPGCVSEMPKIIKTANDYKNKNFQVLAVAQPIDPIESVRQYVKDYGLPFTVMYDADKAVGQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 100-------110-------120-------130-------140-------150 AFGTQVYPTSVLIGKKGEILKTYVGEPDFGKLYQEIDTAWRNSDAEGHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||| AFGTQVYPTSVLIGKKGEILKTYVGEPDFGKLYQEIDTAWRNSDAEGHHHHHH -------110-------120-------130-------140-------150---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 153 | 0 | 0 | 100.0 |
Content subtype: combined_17277_2l5o.nef
Assigned chemical shifts
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- MSLDSKTAPAFSLPDLHGKTVSNADLQGKVTLINFWFPSCPGCVSEMPKIIKTANDYKNKNFQVLAVAQPIDPIESVRQYVKDYGLPFTVMYDADKAVGQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...DSKTAPAFSLPDLHGKTVSNADLQGKVTLINFWFPSCPGCVSEMPKIIKTANDYKNKNFQVLAVAQPIDPIESVRQYVKDYGLPFTVMYDADKAVGQ -----------10--------20--------30--------40--------50--------60--------70--------80--------90------- 100-------110-------120-------130-------140-------150 AFGTQVYPTSVLIGKKGEILKTYVGEPDFGKLYQEIDTAWRNSDAEGHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||| AFGTQVYPTSVLIGKKGEILKTYVGEPDFGKLYQEIDTAWRNSDAEG 100-------110-------120-------130-------140----
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 924 | 861 | 93.2 |
13C chemical shifts | 704 | 650 | 92.3 |
15N chemical shifts | 160 | 149 | 93.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 307 | 289 | 94.1 |
13C chemical shifts | 306 | 285 | 93.1 |
15N chemical shifts | 143 | 134 | 93.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 617 | 572 | 92.7 |
13C chemical shifts | 398 | 365 | 91.7 |
15N chemical shifts | 17 | 15 | 88.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 83 | 80 | 96.4 |
13C chemical shifts | 83 | 80 | 96.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 89 | 71 | 79.8 |
13C chemical shifts | 87 | 69 | 79.3 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- MSLDSKTAPAFSLPDLHGKTVSNADLQGKVTLINFWFPSCPGCVSEMPKIIKTANDYKNKNFQVLAVAQPIDPIESVRQYVKDYGLPFTVMYDADKAVGQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...DSKTAPAFSLPDLHGKTVSNADLQGKVTLINFWFPSCPGCVSEMPKIIKTANDYKNKNFQVLAVAQPIDPIESVRQYVKDYGLPFTVMYDADKAVGQ -----------10--------20--------30--------40--------50--------60--------70--------80--------90------- 100-------110-------120-------130-------140-------150 AFGTQVYPTSVLIGKKGEILKTYVGEPDFGKLYQEIDTAWRNSDAEGHHHHHH |||||||||||||||||||||||||||||||||||||||||| ||| AFGTQVYPTSVLIGKKGEILKTYVGEPDFGKLYQEIDTAWRN.DAE 100-------110-------120-------130-------140---
Dihedral angle restraints
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- MSLDSKTAPAFSLPDLHGKTVSNADLQGKVTLINFWFPSCPGCVSEMPKIIKTANDYKNKNFQVLAVAQPIDPIESVRQYVKDYGLPFTVMYDADKAVGQ ||||||| |||||||||||||||||||| |||||||||||||||||||| |||||||| ||||||||||||| |||||||||||||| .........AFSLPDL.GKTVSNADLQGKVTLINFWF..CPGCVSEMPKIIKTANDYKN.NFQVLAVA....PIESVRQYVKDYG.PFTVMYDADKAVGQ -----------10--------20--------30--------40--------50--------60--------70--------80--------90------- 100-------110-------120-------130-------140-------150 AFGTQVYPTSVLIGKKGEILKTYVGEPDFGKLYQEIDTAWRNSDAEGHHHHHH ||| |||||||||| |||||| |||||||||||||||| AFG.QVYPTSVLIG.....LKTYVG.PDFGKLYQEIDTAWRN 100-------110-------120-------130---------