Solution NMR Structure of BVU_3817 from , Northeast Structural Genomics Consortium Target BvR159
MLKTILSIAG KPGLYKLISQ GKNMLIVETV DAAKKRVPAY AHDKVISLAD IAMYTDAEEV PLSEVLEAVK KKENGAVASI NYKKASADEL HAYFAEVLPN YDRDRVHNGD IKKLISWYNI LVNNGITEFV EAPALEHHHH HH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.7 % (1406 of 1660) | 83.8 % (717 of 856) | 85.1 % (559 of 657) | 88.4 % (130 of 147) |
Backbone | 90.7 % (764 of 842) | 89.1 % (254 of 285) | 92.4 % (388 of 420) | 89.1 % (122 of 137) |
Sidechain | 80.5 % (768 of 954) | 81.1 % (463 of 571) | 79.6 % (297 of 373) | 80.0 % (8 of 10) |
Aromatic | 56.5 % (70 of 124) | 71.0 % (44 of 62) | 41.0 % (25 of 61) | 100.0 % (1 of 1) |
Methyl | 97.3 % (181 of 186) | 97.8 % (91 of 93) | 96.8 % (90 of 93) |
1. BvR159
MLKTILSIAG KPGLYKLISQ GKNMLIVETV DAAKKRVPAY AHDKVISLAD IAMYTDAEEV PLSEVLEAVK KKENGAVASI NYKKASADEL HAYFAEVLPN YDRDRVHNGD IKKLISWYNI LVNNGITEFV EAPALEHHHH HHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.78 mM [U-98% 13C; U-98% 15N] BvR159, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BvR159 | [U-98% 13C; U-98% 15N] | 0.78 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM | |
6 | D2O | natural abundance | 5 % | |
7 | H2O | natural abundance | 95 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.66 mM [U-5% 13C; U-98% 15N] BvR159, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | BvR159 | [5% U-98% 13C; U-98% 15N] | 0.66 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 5 mM | |
11 | sodium azide | natural abundance | 0.02 % | |
12 | TRIS | natural abundance | 10 mM | |
13 | D2O | natural abundance | 5 % | |
14 | H2O | natural abundance | 95 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 7% Positively Charged Compressed GEL
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | BvR159 | [5% U-98% 13C; U-98% 15N] | 0.61 mM | |
16 | sodium chloride | natural abundance | 100 mM | |
17 | DTT | natural abundance | 5 mM | |
18 | sodium azide | natural abundance | 0.02 % | |
19 | TRIS | natural abundance | 10 mM | |
20 | D2O | natural abundance | 5 % | |
21 | H2O | natural abundance | 95 % | |
22 | PAGE | natural abundance | 7 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.78 mM [U-98% 13C; U-98% 15N] BvR159, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BvR159 | [U-98% 13C; U-98% 15N] | 0.78 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM | |
6 | D2O | natural abundance | 5 % | |
7 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.78 mM [U-98% 13C; U-98% 15N] BvR159, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BvR159 | [U-98% 13C; U-98% 15N] | 0.78 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM | |
6 | D2O | natural abundance | 5 % | |
7 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.78 mM [U-98% 13C; U-98% 15N] BvR159, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BvR159 | [U-98% 13C; U-98% 15N] | 0.78 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM | |
6 | D2O | natural abundance | 5 % | |
7 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.78 mM [U-98% 13C; U-98% 15N] BvR159, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BvR159 | [U-98% 13C; U-98% 15N] | 0.78 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM | |
6 | D2O | natural abundance | 5 % | |
7 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.78 mM [U-98% 13C; U-98% 15N] BvR159, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BvR159 | [U-98% 13C; U-98% 15N] | 0.78 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM | |
6 | D2O | natural abundance | 5 % | |
7 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.78 mM [U-98% 13C; U-98% 15N] BvR159, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BvR159 | [U-98% 13C; U-98% 15N] | 0.78 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM | |
6 | D2O | natural abundance | 5 % | |
7 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.78 mM [U-98% 13C; U-98% 15N] BvR159, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BvR159 | [U-98% 13C; U-98% 15N] | 0.78 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM | |
6 | D2O | natural abundance | 5 % | |
7 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.78 mM [U-98% 13C; U-98% 15N] BvR159, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BvR159 | [U-98% 13C; U-98% 15N] | 0.78 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM | |
6 | D2O | natural abundance | 5 % | |
7 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.78 mM [U-98% 13C; U-98% 15N] BvR159, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BvR159 | [U-98% 13C; U-98% 15N] | 0.78 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM | |
6 | D2O | natural abundance | 5 % | |
7 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.66 mM [U-5% 13C; U-98% 15N] BvR159, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | BvR159 | [5% U-98% 13C; U-98% 15N] | 0.66 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 5 mM | |
11 | sodium azide | natural abundance | 0.02 % | |
12 | TRIS | natural abundance | 10 mM | |
13 | D2O | natural abundance | 5 % | |
14 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 7% Positively Charged Compressed GEL
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | BvR159 | [5% U-98% 13C; U-98% 15N] | 0.61 mM | |
16 | sodium chloride | natural abundance | 100 mM | |
17 | DTT | natural abundance | 5 mM | |
18 | sodium azide | natural abundance | 0.02 % | |
19 | TRIS | natural abundance | 10 mM | |
20 | D2O | natural abundance | 5 % | |
21 | H2O | natural abundance | 95 % | |
22 | PAGE | natural abundance | 7 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, RDC restraints | combined_17280_2l5q.nef |
Input source #2: Coordindates | 2l5q.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLKTILSIAGKPGLYKLISQGKNMLIVETVDAAKKRVPAYAHDKVISLADIAMYTDAEEVPLSEVLEAVKKKENGAVASINYKKASADELHAYFAEVLPN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MLKTILSIAGKPGLYKLISQGKNMLIVETVDAAKKRVPAYAHDKVISLADIAMYTDAEEVPLSEVLEAVKKKENGAVASINYKKASADELHAYFAEVLPN -------110-------120-------130-------140-- YDRDRVHNGDIKKLISWYNILVNNGITEFVEAPALEHHHHHH |||||||||||||||||||||||||||||||||||||||||| YDRDRVHNGDIKKLISWYNILVNNGITEFVEAPALEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 142 | 0 | 0 | 100.0 |
Content subtype: combined_17280_2l5q.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLKTILSIAGKPGLYKLISQGKNMLIVETVDAAKKRVPAYAHDKVISLADIAMYTDAEEVPLSEVLEAVKKKENGAVASINYKKASADELHAYFAEVLPN ||||||||| |||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||| MLKTILSIA..PGLYKLISQG.NMLIVETVDAAKKRVPAYAHDKVISLADIAMYTDAEEVPLSEVLEAVKK.ENGAVASINYKKASADELHAYFAEVLPN --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-- YDRDRVHNGDIKKLISWYNILVNNGITEFVEAPALEHHHHHH ||||||| ||||||||||||||||||||||||||||| YDRDRVH.GDIKKLISWYNILVNNGITEFVEAPALEH -------110-------120-------130-------
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
118 | TYR | HH | 10.375 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 856 | 705 | 82.4 |
13C chemical shifts | 657 | 551 | 83.9 |
15N chemical shifts | 150 | 125 | 83.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 285 | 252 | 88.4 |
13C chemical shifts | 284 | 261 | 91.9 |
15N chemical shifts | 137 | 117 | 85.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 571 | 453 | 79.3 |
13C chemical shifts | 373 | 290 | 77.7 |
15N chemical shifts | 13 | 8 | 61.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 96 | 92 | 95.8 |
13C chemical shifts | 96 | 90 | 93.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 62 | 43 | 69.4 |
13C chemical shifts | 61 | 24 | 39.3 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLKTILSIAGKPGLYKLISQGKNMLIVETVDAAKKRVPAYAHDKVISLADIAMYTDAEEVPLSEVLEAVKKKENGAVASINYKKASADELHAYFAEVLPN ||||||||| |||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||| MLKTILSIA..PGLYKLISQG.NMLIVETVDAAKKRVPAYAHDKVISLADIAMYTDAEEVPLSEVLEAVKK.ENGAVASINYKKASADELHAYFAEVLPN --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-- YDRDRVHNGDIKKLISWYNILVNNGITEFVEAPALEHHHHHH ||||||| ||||||||||||||||||||||||||||| YDRDRVH.GDIKKLISWYNILVNNGITEFVEAPALEH -------110-------120-------130-------
RDC restraints