NMR structure of calcium-loaded STIM2 EF-SAM.
GSHMASTEED RFSLEALQTI HKQMDDDKDG GIEVEESDEF IREDMKYKDA TNKHSHLHRE DKHITIEDLW KRWKTSEVHN WTLEDTLQWL IEFVELPQYE KNFRDNNVKG TTLPRIAVHE PSFMISQLKI SDRSHRQKLQ LKALDVVLFG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 77.7 % (1416 of 1823) | 84.5 % (807 of 955) | 65.7 % (463 of 705) | 89.6 % (146 of 163) |
Backbone | 79.0 % (706 of 894) | 90.7 % (274 of 302) | 66.7 % (297 of 445) | 91.8 % (135 of 147) |
Sidechain | 78.5 % (843 of 1074) | 81.6 % (533 of 653) | 73.8 % (299 of 405) | 68.8 % (11 of 16) |
Aromatic | 30.0 % (48 of 160) | 55.0 % (44 of 80) | 0.0 % (0 of 76) | 100.0 % (4 of 4) |
Methyl | 97.3 % (144 of 148) | 95.9 % (71 of 74) | 98.6 % (73 of 74) |
1. Stromal Interaction Molecule 2
GSHMASTEED RFSLEALQTI HKQMDDDKDG GIEVEESDEF IREDMKYKDA TNKHSHLHRE DKHITIEDLW KRWKTSEVHN WTLEDTLQWL IEFVELPQYE KNFRDNNVKG TTLPRIAVHE PSFMISQLKI SDRSHRQKLQ LKALDVVLFGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PROTEIN (Stromal Interaction Molecule 2) | [U-99% 15N] | 0.5 ~ 0.7 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | Calcium Ion | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | PROTEIN (Stromal Interaction Molecule 2) | [U-99% 13C; U-99% 15N] | 0.5 ~ 0.7 mM | |
8 | TRIS | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | Calcium Ion | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 288 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | PROTEIN (Stromal Interaction Molecule 2) | [U-99% 13C; U-99% 15N] | 0.5 ~ 0.7 mM | |
14 | TRIS | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 100 mM | |
16 | CALCIUM ION | natural abundance | 10 mM | |
17 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PROTEIN (Stromal Interaction Molecule 2) | [U-99% 15N] | 0.5 ~ 0.7 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | Calcium Ion | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | PROTEIN (Stromal Interaction Molecule 2) | [U-99% 13C; U-99% 15N] | 0.5 ~ 0.7 mM | |
8 | TRIS | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | Calcium Ion | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | PROTEIN (Stromal Interaction Molecule 2) | [U-99% 13C; U-99% 15N] | 0.5 ~ 0.7 mM | |
8 | TRIS | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | Calcium Ion | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PROTEIN (Stromal Interaction Molecule 2) | [U-99% 15N] | 0.5 ~ 0.7 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | Calcium Ion | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 288 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | PROTEIN (Stromal Interaction Molecule 2) | [U-99% 13C; U-99% 15N] | 0.5 ~ 0.7 mM | |
14 | TRIS | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 100 mM | |
16 | CALCIUM ION | natural abundance | 10 mM | |
17 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | PROTEIN (Stromal Interaction Molecule 2) | [U-99% 13C; U-99% 15N] | 0.5 ~ 0.7 mM | |
8 | TRIS | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | Calcium Ion | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | PROTEIN (Stromal Interaction Molecule 2) | [U-99% 13C; U-99% 15N] | 0.5 ~ 0.7 mM | |
8 | TRIS | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | Calcium Ion | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | PROTEIN (Stromal Interaction Molecule 2) | [U-99% 13C; U-99% 15N] | 0.5 ~ 0.7 mM | |
8 | TRIS | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | Calcium Ion | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | PROTEIN (Stromal Interaction Molecule 2) | [U-99% 13C; U-99% 15N] | 0.5 ~ 0.7 mM | |
8 | TRIS | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | Calcium Ion | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 288 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | PROTEIN (Stromal Interaction Molecule 2) | [U-99% 13C; U-99% 15N] | 0.5 ~ 0.7 mM | |
14 | TRIS | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 100 mM | |
16 | CALCIUM ION | natural abundance | 10 mM | |
17 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 288 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | PROTEIN (Stromal Interaction Molecule 2) | [U-99% 13C; U-99% 15N] | 0.5 ~ 0.7 mM | |
14 | TRIS | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 100 mM | |
16 | CALCIUM ION | natural abundance | 10 mM | |
17 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 288 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | PROTEIN (Stromal Interaction Molecule 2) | [U-99% 13C; U-99% 15N] | 0.5 ~ 0.7 mM | |
14 | TRIS | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 100 mM | |
16 | CALCIUM ION | natural abundance | 10 mM | |
17 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17289_2l5y.nef |
Input source #2: Coordindates | 2l5y.cif |
Diamagnetism of the molecular assembly | False (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:36:GLU:OE1 | 2:1:CA:CA | unknown | unknown | n/a |
1:33:GLU:OE2 | 2:1:CA:CA | unknown | unknown | n/a |
1:29:ASP:OD2 | 2:1:CA:CA | unknown | unknown | n/a |
1:36:GLU:OE2 | 2:1:CA:CA | unknown | unknown | n/a |
1:31:GLY:O | 2:1:CA:CA | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | CA | CALCIUM ION | None |
Sequence alignments
-------------70--------80--------90-------100-------110-------120-------130-------140-------150----- GSHMASTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMASTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --160-------170-------180-------190-------200----- KNFRDNNVKGTTLPRIAVHEPSFMISQLKISDRSHRQKLQLKALDVVLFG |||||||||||||||||||||||||||||||||||||||||||||||||| KNFRDNNVKGTTLPRIAVHEPSFMISQLKISDRSHRQKLQLKALDVVLFG -------110-------120-------130-------140-------150
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 150 | 0 | 0 | 100.0 |
Content subtype: combined_17289_2l5y.nef
Assigned chemical shifts
-------------70--------80--------90-------100-------110-------120-------130-------140-------150----- GSHMASTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYE | |||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||| G...ASTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATN.HSHLHREDKHITIEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYE --160-------170-------180-------190-------200----- KNFRDNNVKGTTLPRIAVHEPSFMISQLKISDRSHRQKLQLKALDVVLFG |||||||||||||||||||| ||||||||||||||||||||||||||||| KNFRDNNVKGTTLPRIAVHE.SFMISQLKISDRSHRQKLQLKALDVVLFG
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 955 | 804 | 84.2 |
15N chemical shifts | 171 | 141 | 82.5 |
13C chemical shifts | 705 | 431 | 61.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 302 | 272 | 90.1 |
15N chemical shifts | 147 | 131 | 89.1 |
13C chemical shifts | 300 | 136 | 45.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 653 | 532 | 81.5 |
15N chemical shifts | 24 | 10 | 41.7 |
13C chemical shifts | 405 | 295 | 72.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 78 | 76 | 97.4 |
13C chemical shifts | 78 | 76 | 97.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 80 | 44 | 55.0 |
15N chemical shifts | 4 | 4 | 100.0 |
13C chemical shifts | 76 | 0 | 0.0 |
Covalent bonds
Distance restraints
-------------70--------80--------90-------100-------110-------120-------130-------140-------150----- GSHMASTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYE |||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||| ......TEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATN.HSHLHREDKHITIEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYE ---60--------70--------80--------90-------100-------110-------120-------130-------140-------150----- --160-------170-------180-------190-------200----- KNFRDNNVKGTTLPRIAVHEPSFMISQLKISDRSHRQKLQLKALDVVLFG |||||||||||||||||||| |||||||||| |||||||||||||||||| KNFRDNNVKGTTLPRIAVHE.SFMISQLKIS.RSHRQKLQLKALDVVLFG --160-------170-------180-------190-------200-----
Dihedral angle restraints
-------------70--------80--------90-------100-------110-------120-------130-------140-------150----- GSHMASTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYE |||||||||||||||||||||| |||||||||||||||| ||||||||| |||||||||||| |||||||||||||||||| || ......TEEDRFSLEALQTIHKQMDDDK..GIEVEESDEFIREDMK...ATNKHSHLH....HITIEDLWKRWK.SEVHNWTLEDTLQWLIEF.....YE ---60--------70--------80--------90-------100-------110-------120-------130-------140-------150----- --160-------170-------180-------190-------200----- KNFRDNNVKGTTLPRIAVHEPSFMISQLKISDRSHRQKLQLKALDVVLFG ||||||| ||||||| |||||||||||||||||| KNFRDNN...............FMISQLK..DRSHRQKLQLKALDVVLF --160-------170-------180-------190-------200----
-------------70--------80--------90-------100-------110-------120-------130-------140-------150----- GSHMASTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYE |||||||||||||||||||||| |||||||||||||||| ||||||||| |||||||||||| |||||||||||||||||| || ......TEEDRFSLEALQTIHKQMDDDK..GIEVEESDEFIREDMK...ATNKHSHLH....HITIEDLWKRWK.SEVHNWTLEDTLQWLIEF.....YE ---60--------70--------80--------90-------100-------110-------120-------130-------140-------150----- --160-------170-------180-------190-------200----- KNFRDNNVKGTTLPRIAVHEPSFMISQLKISDRSHRQKLQLKALDVVLFG ||||||| ||||||| |||||||||||||||||| KNFRDNN...............FMISQLK..DRSHRQKLQLKALDVVLF --160-------170-------180-------190-------200----