NMR solution structure of the protein YP_001092504.1
GMTPQSDTPK VTGLKLKRKS RQLEISFDNG QQFTLSCELL RVYSPSAEVH GHGNPVLVTH KKNVNINAIT PVGNYAVKLV FDDGHDTGLY SWKVLYDLAS NQVDLWENYL ARLRAAKASR EPLIDMAVKY HT
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.8 % (1466 of 1546) | 97.3 % (779 of 801) | 91.1 % (550 of 604) | 97.2 % (137 of 141) |
Backbone | 95.9 % (748 of 780) | 98.5 % (262 of 266) | 93.8 % (364 of 388) | 96.8 % (122 of 126) |
Sidechain | 94.6 % (842 of 890) | 96.6 % (517 of 535) | 91.2 % (310 of 340) | 100.0 % (15 of 15) |
Aromatic | 66.4 % (81 of 122) | 78.7 % (48 of 61) | 52.5 % (31 of 59) | 100.0 % (2 of 2) |
Methyl | 98.7 % (156 of 158) | 98.7 % (78 of 79) | 98.7 % (78 of 79) |
1. YP 001092504.1
GMTPQSDTPK VTGLKLKRKS RQLEISFDNG QQFTLSCELL RVYSPSAEVH GHGNPVLVTH KKNVNINAIT PVGNYAVKLV FDDGHDTGLY SWKVLYDLAS NQVDLWENYL ARLRAAKASR EPLIDMAVKY HTSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.2mM [U-98% 13C; U-98% 15N] Protein-YP_001092504.1, 50mM NaCl, 20mM Sodium Phosphate, 4.5 mM sodium azide, 95% H20/5%D20
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 50 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | Protein-YP_001092504.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.2mM [U-98% 13C; U-98% 15N] Protein-YP_001092504.1, 50mM NaCl, 20mM Sodium Phosphate, 4.5 mM sodium azide, 95% H20/5%D20
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 50 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | Protein-YP_001092504.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.2mM [U-98% 13C; U-98% 15N] Protein-YP_001092504.1, 50mM NaCl, 20mM Sodium Phosphate, 4.5 mM sodium azide, 95% H20/5%D20
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 50 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | Protein-YP_001092504.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.2mM [U-98% 13C; U-98% 15N] Protein-YP_001092504.1, 50mM NaCl, 20mM Sodium Phosphate, 4.5 mM sodium azide, 95% H20/5%D20
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 50 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | Protein-YP_001092504.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.2mM [U-98% 13C; U-98% 15N] Protein-YP_001092504.1, 50mM NaCl, 20mM Sodium Phosphate, 4.5 mM sodium azide, 95% H20/5%D20
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 50 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | Protein-YP_001092504.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.2mM [U-98% 13C; U-98% 15N] Protein-YP_001092504.1, 50mM NaCl, 20mM Sodium Phosphate, 4.5 mM sodium azide, 95% H20/5%D20
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 50 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | Protein-YP_001092504.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.2mM [U-98% 13C; U-98% 15N] Protein-YP_001092504.1, 50mM NaCl, 20mM Sodium Phosphate, 4.5 mM sodium azide, 95% H20/5%D20
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 50 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | Protein-YP_001092504.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.2mM [U-98% 13C; U-98% 15N] Protein-YP_001092504.1, 50mM NaCl, 20mM Sodium Phosphate, 4.5 mM sodium azide, 95% H20/5%D20
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 50 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | Protein-YP_001092504.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.2mM [U-98% 13C; U-98% 15N] Protein-YP_001092504.1, 50mM NaCl, 20mM Sodium Phosphate, 4.5 mM sodium azide, 95% H20/5%D20
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 50 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | Protein-YP_001092504.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.2mM [U-98% 13C; U-98% 15N] Protein-YP_001092504.1, 50mM NaCl, 20mM Sodium Phosphate, 4.5 mM sodium azide, 95% H20/5%D20
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 50 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | Protein-YP_001092504.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_17318_2l6n.nef |
Input source #2: Coordindates | 2l6n.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GMTPQSDTPKVTGLKLKRKSRQLEISFDNGQQFTLSCELLRVYSPSAEVHGHGNPVLVTHKKNVNINAITPVGNYAVKLVFDDGHDTGLYSWKVLYDLAS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GMTPQSDTPKVTGLKLKRKSRQLEISFDNGQQFTLSCELLRVYSPSAEVHGHGNPVLVTHKKNVNINAITPVGNYAVKLVFDDGHDTGLYSWKVLYDLAS -------110-------120-------130-- NQVDLWENYLARLRAAKASREPLIDMAVKYHT |||||||||||||||||||||||||||||||| NQVDLWENYLARLRAAKASREPLIDMAVKYHT
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 132 | 0 | 0 | 100.0 |
Content subtype: combined_17318_2l6n.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GMTPQSDTPKVTGLKLKRKSRQLEISFDNGQQFTLSCELLRVYSPSAEVHGHGNPVLVTHKKNVNINAITPVGNYAVKLVFDDGHDTGLYSWKVLYDLAS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .MTPQSDTPKVTGLKLKRKSRQLEISFDNGQQFTLSCELLRVYSPSAEVHGHGNPVLVTHKKNVNINAITPVGNYAVKLVFDDGHDTGLYSWKVLYDLAS -------110-------120-------130-- NQVDLWENYLARLRAAKASREPLIDMAVKYHT |||||||||||||||||||||||||||||||| NQVDLWENYLARLRAAKASREPLIDMAVKYHT
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 801 | 775 | 96.8 |
13C chemical shifts | 604 | 542 | 89.7 |
15N chemical shifts | 147 | 140 | 95.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 266 | 258 | 97.0 |
13C chemical shifts | 264 | 232 | 87.9 |
15N chemical shifts | 126 | 120 | 95.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 535 | 517 | 96.6 |
13C chemical shifts | 340 | 310 | 91.2 |
15N chemical shifts | 21 | 20 | 95.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 81 | 79 | 97.5 |
13C chemical shifts | 81 | 79 | 97.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 48 | 78.7 |
13C chemical shifts | 59 | 31 | 52.5 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GMTPQSDTPKVTGLKLKRKSRQLEISFDNGQQFTLSCELLRVYSPSAEVHGHGNPVLVTHKKNVNINAITPVGNYAVKLVFDDGHDTGLYSWKVLYDLAS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .MTPQSDTPKVTGLKLKRKSRQLEISFDNGQQFTLSCELLRVYSPSAEVHGHGNPVLVTHKKNVNINAITPVGNYAVKLVFDDGHDTGLYSWKVLYDLAS -------110-------120-------130-- NQVDLWENYLARLRAAKASREPLIDMAVKYHT |||||||||||||||||||||||||||||||| NQVDLWENYLARLRAAKASREPLIDMAVKYHT