NMR solution structure of the protein NP_253742.1
GMRIPSAIQL HKASKTLTLR YGEDSYDLPA EFLRVHSPSA EVQGHGNPVL QYGKLNVGLV GVEPAGQYAL KLSFDDGHDS GLFTWDYLYE LATRKDQLWA DYLAELASAG KSRDPDESVV KLML
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.7 % (1275 of 1422) | 92.2 % (677 of 734) | 85.2 % (478 of 561) | 94.5 % (120 of 127) |
Backbone | 91.5 % (670 of 732) | 94.1 % (238 of 253) | 88.9 % (321 of 361) | 94.1 % (111 of 118) |
Sidechain | 88.9 % (714 of 803) | 91.3 % (439 of 481) | 85.0 % (266 of 313) | 100.0 % (9 of 9) |
Aromatic | 76.2 % (96 of 126) | 90.5 % (57 of 63) | 60.7 % (37 of 61) | 100.0 % (2 of 2) |
Methyl | 84.5 % (120 of 142) | 85.9 % (61 of 71) | 83.1 % (59 of 71) |
1. NP 253742.1
GMRIPSAIQL HKASKTLTLR YGEDSYDLPA EFLRVHSPSA EVQGHGNPVL QYGKLNVGLV GVEPAGQYAL KLSFDDGHDS GLFTWDYLYE LATRKDQLWA DYLAELASAG KSRDPDESVV KLMLSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.2mM [U-98% 13C; U-98% 15N]protein-NP_253742.1, 50mM NaCl, 20mM Sodium Phosphate, 4.5 mM sodium azide, 95% H20/5%D20
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 50 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | protein-NP_253742.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.2mM [U-98% 13C; U-98% 15N]protein-NP_253742.1, 50mM NaCl, 20mM Sodium Phosphate, 4.5 mM sodium azide, 95% H20/5%D20
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 50 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | protein-NP_253742.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.2mM [U-98% 13C; U-98% 15N]protein-NP_253742.1, 50mM NaCl, 20mM Sodium Phosphate, 4.5 mM sodium azide, 95% H20/5%D20
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 50 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | protein-NP_253742.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.2mM [U-98% 13C; U-98% 15N]protein-NP_253742.1, 50mM NaCl, 20mM Sodium Phosphate, 4.5 mM sodium azide, 95% H20/5%D20
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 50 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | protein-NP_253742.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.2mM [U-98% 13C; U-98% 15N]protein-NP_253742.1, 50mM NaCl, 20mM Sodium Phosphate, 4.5 mM sodium azide, 95% H20/5%D20
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 50 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | protein-NP_253742.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.2mM [U-98% 13C; U-98% 15N]protein-NP_253742.1, 50mM NaCl, 20mM Sodium Phosphate, 4.5 mM sodium azide, 95% H20/5%D20
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 50 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | protein-NP_253742.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.2mM [U-98% 13C; U-98% 15N]protein-NP_253742.1, 50mM NaCl, 20mM Sodium Phosphate, 4.5 mM sodium azide, 95% H20/5%D20
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 50 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | protein-NP_253742.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.2mM [U-98% 13C; U-98% 15N]protein-NP_253742.1, 50mM NaCl, 20mM Sodium Phosphate, 4.5 mM sodium azide, 95% H20/5%D20
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 50 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | protein-NP_253742.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.2mM [U-98% 13C; U-98% 15N]protein-NP_253742.1, 50mM NaCl, 20mM Sodium Phosphate, 4.5 mM sodium azide, 95% H20/5%D20
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 50 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | protein-NP_253742.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 1.2mM [U-98% 13C; U-98% 15N]protein-NP_253742.1, 50mM NaCl, 20mM Sodium Phosphate, 4.5 mM sodium azide, 95% H20/5%D20
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 50 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 4.5 mM | |
4 | protein-NP_253742.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_17319_2l6p.nef |
Input source #2: Coordindates | 2l6p.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GMRIPSAIQLHKASKTLTLRYGEDSYDLPAEFLRVHSPSAEVQGHGNPVLQYGKLNVGLVGVEPAGQYALKLSFDDGHDSGLFTWDYLYELATRKDQLWA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GMRIPSAIQLHKASKTLTLRYGEDSYDLPAEFLRVHSPSAEVQGHGNPVLQYGKLNVGLVGVEPAGQYALKLSFDDGHDSGLFTWDYLYELATRKDQLWA -------110-------120---- DYLAELASAGKSRDPDESVVKLML |||||||||||||||||||||||| DYLAELASAGKSRDPDESVVKLML
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 124 | 0 | 0 | 100.0 |
Content subtype: combined_17319_2l6p.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GMRIPSAIQLHKASKTLTLRYGEDSYDLPAEFLRVHSPSAEVQGHGNPVLQYGKLNVGLVGVEPAGQYALKLSFDDGHDSGLFTWDYLYELATRKDQLWA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||| .MRIPSAIQLHKASKTLTLRYGEDSYDLPAEFLRVHSPSAEVQGHGNPVLQYGKLNVGLVGVEPAGQYALKLSFDDGHDSG.FTWDYLYELATRKDQLWA -------110-------120---- DYLAELASAGKSRDPDESVVKLML ||||||||||||||||||||| || DYLAELASAGKSRDPDESVVK.ML
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
11 | HIS | ND1 | 201.737 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 734 | 690 | 94.0 |
13C chemical shifts | 561 | 479 | 85.4 |
15N chemical shifts | 132 | 125 | 94.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 253 | 242 | 95.7 |
13C chemical shifts | 248 | 213 | 85.9 |
15N chemical shifts | 118 | 111 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 481 | 448 | 93.1 |
13C chemical shifts | 313 | 266 | 85.0 |
15N chemical shifts | 14 | 14 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 73 | 64 | 87.7 |
13C chemical shifts | 73 | 60 | 82.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 57 | 90.5 |
13C chemical shifts | 61 | 37 | 60.7 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GMRIPSAIQLHKASKTLTLRYGEDSYDLPAEFLRVHSPSAEVQGHGNPVLQYGKLNVGLVGVEPAGQYALKLSFDDGHDSGLFTWDYLYELATRKDQLWA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||| .MRIPSAIQLHKASKTLTLRYGEDSYDLPAEFLRVHSPSAEVQGHGNPVLQYGKLNVGLVGVEPAGQYALKLSFDDGHDSG.FTWDYLYELATRKDQLWA --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120---- DYLAELASAGKSRDPDESVVKLML ||||||||||||||||||||| DYLAELASAGKSRDPDESVVK -------110-------120-