BMRBj - BMREntryMaster

Found 1 Document (0.861 seconds)

BMRB: 17359

2L7K

Solution NMR Structure of protein CD1104.2 from Clostridium difficile, Northeast Structural Genomics Consortium Target CfR130

Authors

Pulavarti, S., Eletsky, A., Mills, J.L., Sukumaran, D.K., Wang, H., Ciccosanti, C., Janjua, H., Acton, T.B., Xiao, R., Everett, J.K., Lee, H., Prestegard, J.H., Montelione, G.T., Szyperski, T.

Assembly

CfR130

Entity

1. CfR130 (polymer, Thiol state: not present), 76 monomers, 8737.843 Da Detail

MIRLTIEETN LLSIYNEGGK RGLMENINAA LPFMDEDMRE LAKRTLAKIA PLTENEYAEL AIFAADEVLE HHHHHH

Formula weight

8737.843 Da

Source organism

Clostridioides difficile

Exptl. method

solution NMR

Refine. method

simulated annealing

Data set

assigned_chemical_shifts

Chem. Shift Complete

Sequence coverage: 93.4 %, Completeness: 89.5 %, Completeness (bb): 88.5 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	89.5 % (794 of 887)	90.2 % (414 of 459)	88.8 % (310 of 349)	88.6 % (70 of 79)
Backbone	88.5 % (400 of 452)	88.9 % (136 of 153)	88.4 % (199 of 225)	87.8 % (65 of 74)
Sidechain	90.6 % (460 of 508)	90.8 % (278 of 306)	89.8 % (177 of 197)	100.0 % (5 of 5)
Aromatic	60.0 % (36 of 60)	60.0 % (18 of 30)	60.0 % (18 of 30)
Methyl	95.7 % (90 of 94)	93.6 % (44 of 47)	97.9 % (46 of 47)

1. CfR130

MIRLTIEETN LLSIYNEGGK RGLMENINAA LPFMDEDMRE LAKRTLAKIA PLTENEYAEL AIFAADEVLE HHHHHH

Show sample condition

Sample #1

Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.61 mM [U-100% 13C; U-100% 15N], 95% H2O/5% D2O

#	Name	Isotope labeling	Concentration
1	CfR130	[U-100% 13C; U-100% 15N]	1.61 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.02 %
5	calcium chloride	natural abundance	5 mM
6	DTT	natural abundance	10 mM
7	DSS	natural abundance	50 uM
8	D2O	natural abundance	5 %
9	H2O	natural abundance	95 %

Sample #2

Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.68 mM [U-5% 13C; U-100% 15N], 95% H2O/5% D2O

#	Name	Isotope labeling	Concentration
10	CfR130	[U-5% 13C; U-100% 15N]	1.68 mM
11	MES	natural abundance	20 mM
12	sodium chloride	natural abundance	100 mM
13	sodium azide	natural abundance	0.02 %
14	calcium chloride	natural abundance	5 mM
15	DTT	natural abundance	10 mM
16	DSS	natural abundance	50 uM
17	D2O	natural abundance	5 %
18	H2O	natural abundance	95 %

Sample #3

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.68 mM [U-5% 13C; U-100% 15N] 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
19	CfR130	[U-5% 13C; U-100% 15N]	1.68 mM
20	MES	natural abundance	20 mM
21	sodium chloride	natural abundance	100 mM
22	sodium azide	natural abundance	0.02 %
23	calcium chloride	natural abundance	5 mM
24	DTT	natural abundance	10 mM
25	DSS	natural abundance	50 uM
26	D2O	natural abundance	10 %
27	H2O	natural abundance	90 %
28	PEG	natural abundance	4 %

Sample #4

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.68 mM [U-5% 13C; U-100% 15N] 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
29	CfR130	[U-5% 13C; U-100% 15N]	1.68 mM
30	MES	natural abundance	20 mM
31	sodium chloride	natural abundance	100 mM
32	sodium azide	natural abundance	0.02 %
33	calcium chloride	natural abundance	5 mM
34	DTT	natural abundance	10 mM
35	DSS	natural abundance	50 uM
36	D2O	natural abundance	10 %
37	H2O	natural abundance	90 %
38	Pf1 phage	natural abundance	13.2 mg/mL

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.12 ppm, Outliers: 1 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.12 ppm, Outliers: 1 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.03 ppm, Outliers: 1 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.1 ppm, Outliers: 1 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2L7K, Strand ID: A Detail

Release date

2011-01-04

Related entities 1. CfR130, : 1 : 4 entities Detail

Experiments performed 15 experiments Detail

1 2D 1H-15N HSQC

Instrument

Varian INOVA - 750 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.61 mM [U-100% 13C; U-100% 15N], 95% H2O/5% D2O

#	Name	Isotope labeling	Concentration
1	CfR130	[U-100% 13C; U-100% 15N]	1.61 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.02 %
5	calcium chloride	natural abundance	5 mM
6	DTT	natural abundance	10 mM
7	DSS	natural abundance	50 uM
8	D2O	natural abundance	5 %
9	H2O	natural abundance	95 %

2 2D 1H-13C HSQC aliphatic

Instrument

Varian INOVA - 750 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.61 mM [U-100% 13C; U-100% 15N], 95% H2O/5% D2O

#	Name	Isotope labeling	Concentration
1	CfR130	[U-100% 13C; U-100% 15N]	1.61 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.02 %
5	calcium chloride	natural abundance	5 mM
6	DTT	natural abundance	10 mM
7	DSS	natural abundance	50 uM
8	D2O	natural abundance	5 %
9	H2O	natural abundance	95 %

3 2D 1H-13C HSQC aromatic

Instrument

Varian INOVA - 750 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.61 mM [U-100% 13C; U-100% 15N], 95% H2O/5% D2O

#	Name	Isotope labeling	Concentration
1	CfR130	[U-100% 13C; U-100% 15N]	1.61 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.02 %
5	calcium chloride	natural abundance	5 mM
6	DTT	natural abundance	10 mM
7	DSS	natural abundance	50 uM
8	D2O	natural abundance	5 %
9	H2O	natural abundance	95 %

4 (4,3)D GFT-HNCACBCA

Instrument

Varian INOVA - 500 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.61 mM [U-100% 13C; U-100% 15N], 95% H2O/5% D2O

#	Name	Isotope labeling	Concentration
1	CfR130	[U-100% 13C; U-100% 15N]	1.61 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.02 %
5	calcium chloride	natural abundance	5 mM
6	DTT	natural abundance	10 mM
7	DSS	natural abundance	50 uM
8	D2O	natural abundance	5 %
9	H2O	natural abundance	95 %

5 (4,3)D GFT-CBCACA(CO)NHN

Instrument

Varian INOVA - 500 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.61 mM [U-100% 13C; U-100% 15N], 95% H2O/5% D2O

#	Name	Isotope labeling	Concentration
1	CfR130	[U-100% 13C; U-100% 15N]	1.61 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.02 %
5	calcium chloride	natural abundance	5 mM
6	DTT	natural abundance	10 mM
7	DSS	natural abundance	50 uM
8	D2O	natural abundance	5 %
9	H2O	natural abundance	95 %

6 3D HNCO

Instrument

Varian INOVA - 500 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.61 mM [U-100% 13C; U-100% 15N], 95% H2O/5% D2O

#	Name	Isotope labeling	Concentration
1	CfR130	[U-100% 13C; U-100% 15N]	1.61 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.02 %
5	calcium chloride	natural abundance	5 mM
6	DTT	natural abundance	10 mM
7	DSS	natural abundance	50 uM
8	D2O	natural abundance	5 %
9	H2O	natural abundance	95 %

7 3D HN(CA)CO

Instrument

Varian INOVA - 500 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.61 mM [U-100% 13C; U-100% 15N], 95% H2O/5% D2O

#	Name	Isotope labeling	Concentration
1	CfR130	[U-100% 13C; U-100% 15N]	1.61 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.02 %
5	calcium chloride	natural abundance	5 mM
6	DTT	natural abundance	10 mM
7	DSS	natural abundance	50 uM
8	D2O	natural abundance	5 %
9	H2O	natural abundance	95 %

8 3D GFT HCCH-COSY-ali

Instrument

Varian INOVA - 500 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.61 mM [U-100% 13C; U-100% 15N], 95% H2O/5% D2O

#	Name	Isotope labeling	Concentration
1	CfR130	[U-100% 13C; U-100% 15N]	1.61 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.02 %
5	calcium chloride	natural abundance	5 mM
6	DTT	natural abundance	10 mM
7	DSS	natural abundance	50 uM
8	D2O	natural abundance	5 %
9	H2O	natural abundance	95 %

9 3D GFT HCCH-COSY-aro

Instrument

Varian INOVA - 500 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.61 mM [U-100% 13C; U-100% 15N], 95% H2O/5% D2O

#	Name	Isotope labeling	Concentration
1	CfR130	[U-100% 13C; U-100% 15N]	1.61 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.02 %
5	calcium chloride	natural abundance	5 mM
6	DTT	natural abundance	10 mM
7	DSS	natural abundance	50 uM
8	D2O	natural abundance	5 %
9	H2O	natural abundance	95 %

10 3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY

Instrument

Varian INOVA - 750 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.61 mM [U-100% 13C; U-100% 15N], 95% H2O/5% D2O

#	Name	Isotope labeling	Concentration
1	CfR130	[U-100% 13C; U-100% 15N]	1.61 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.02 %
5	calcium chloride	natural abundance	5 mM
6	DTT	natural abundance	10 mM
7	DSS	natural abundance	50 uM
8	D2O	natural abundance	5 %
9	H2O	natural abundance	95 %

11 3D HCCH-TOCSY-ali

Instrument

Varian INOVA - 500 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.61 mM [U-100% 13C; U-100% 15N], 95% H2O/5% D2O

#	Name	Isotope labeling	Concentration
1	CfR130	[U-100% 13C; U-100% 15N]	1.61 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.02 %
5	calcium chloride	natural abundance	5 mM
6	DTT	natural abundance	10 mM
7	DSS	natural abundance	50 uM
8	D2O	natural abundance	5 %
9	H2O	natural abundance	95 %

12 2D 1H-13C CT-HSQC aliphatic

Instrument

Varian INOVA - 750 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.68 mM [U-5% 13C; U-100% 15N], 95% H2O/5% D2O

#	Name	Isotope labeling	Concentration
10	CfR130	[U-5% 13C; U-100% 15N]	1.68 mM
11	MES	natural abundance	20 mM
12	sodium chloride	natural abundance	100 mM
13	sodium azide	natural abundance	0.02 %
14	calcium chloride	natural abundance	5 mM
15	DTT	natural abundance	10 mM
16	DSS	natural abundance	50 uM
17	D2O	natural abundance	5 %
18	H2O	natural abundance	95 %

13 (4,3)D GFT-HABCAB(CO)NHN

Instrument

Varian INOVA - 500 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.61 mM [U-100% 13C; U-100% 15N], 95% H2O/5% D2O

#	Name	Isotope labeling	Concentration
1	CfR130	[U-100% 13C; U-100% 15N]	1.61 mM
2	MES	natural abundance	20 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.02 %
5	calcium chloride	natural abundance	5 mM
6	DTT	natural abundance	10 mM
7	DSS	natural abundance	50 uM
8	D2O	natural abundance	5 %
9	H2O	natural abundance	95 %

14 2D 1H-15N J-modulated HSQC

Instrument

Varian INOVA - 600 MHz

Sample

State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.68 mM [U-5% 13C; U-100% 15N] 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
19	CfR130	[U-5% 13C; U-100% 15N]	1.68 mM
20	MES	natural abundance	20 mM
21	sodium chloride	natural abundance	100 mM
22	sodium azide	natural abundance	0.02 %
23	calcium chloride	natural abundance	5 mM
24	DTT	natural abundance	10 mM
25	DSS	natural abundance	50 uM
26	D2O	natural abundance	10 %
27	H2O	natural abundance	90 %
28	PEG	natural abundance	4 %

15 2D 1H-15N J-modulated HSQC

Instrument

Varian INOVA - 600 MHz

Sample

State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.68 mM [U-5% 13C; U-100% 15N] 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
29	CfR130	[U-5% 13C; U-100% 15N]	1.68 mM
30	MES	natural abundance	20 mM
31	sodium chloride	natural abundance	100 mM
32	sodium azide	natural abundance	0.02 %
33	calcium chloride	natural abundance	5 mM
34	DTT	natural abundance	10 mM
35	DSS	natural abundance	50 uM
36	D2O	natural abundance	10 %
37	H2O	natural abundance	90 %
38	Pf1 phage	natural abundance	13.2 mg/mL

NMR combined restraints 6 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints	combined_17359_2l7k.nef
Input source #2: Coordindates	2l7k.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50--------60--------70------
MIRLTIEETNLLSIYNEGGKRGLMENINAALPFMDEDMRELAKRTLAKIAPLTENEYAELAIFAADEVLEHHHHHH
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
MIRLTIEETNLLSIYNEGGKRGLMENINAALPFMDEDMRELAKRTLAKIAPLTENEYAELAIFAADEVLEHHHHHH

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	76	0	0	100.0

Content subtype: combined_17359_2l7k.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	811		93.4 (chain: A, length: 76)
1	Distance restraints	CNS/XPLOR_distance_constraints_2	OK	2199 (1)	noe	93.4 (chain: A, length: 76)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_3	OK	72 (72)	.	57.9 (chain: A, length: 76)
1	RDC restraints	CNS/XPLOR_dipolar_coupling_4	OK	40 (40)	.	52.6 (chain: A, length: 76)
2	RDC restraints	CNS/XPLOR_dipolar_coupling_5	OK	39 (39)	.	51.3 (chain: A, length: 76)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 76, Sequence coverage: 93.4%
- Total number of assignments
  - ¹H chemical shifts: 423
  - ¹³C chemical shifts: 314
  - ¹⁵N chemical shifts: 74
- Completeness of assignments
  - Entity_assemble_ID: A
- Peptide bond of PRO
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
53	THR	HG1	5.777

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	459	422	91.9
¹³C chemical shifts	349	314	90.0
¹⁵N chemical shifts	83	74	89.2

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	153	139	90.8
¹³C chemical shifts	152	135	88.8
¹⁵N chemical shifts	74	65	87.8

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	306	283	92.5
¹³C chemical shifts	197	179	90.9
¹⁵N chemical shifts	9	9	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	51	50	98.0
¹³C chemical shifts	51	50	98.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	30	18	60.0
¹³C chemical shifts	30	18	60.0

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_2
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 76, Sequence coverage: 93.4%
- Total number of restraints: 2197
- Weight of restraints: 1.0 (2197)
- Potential type of restraints: square-well-parabolic (2197)
- Range of distance target values: 1.69, 3.15 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_3
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 76, Sequence coverage: 57.9%
- Total number of restraints: 72
- Total number of restraints per polymer type: 72
- Weight of restraints: 1.0 (72)
- Potential type of restraints: square-well-parabolic (72)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

RDC restraints

Saveframe: CNS/XPLOR_dipolar_coupling_4

Status: OK
Experiment type: .

Sequence coverage of experimental data

Entity_assembly_ID: A, Chain length: 76, Sequence coverage: 52.6%

--------10--------20--------30--------40--------50--------60--------70------
MIRLTIEETNLLSIYNEGGKRGLMENINAALPFMDEDMRELAKRTLAKIAPLTENEYAELAIFAADEVLEHHHHHH
  |||| |||||||  |||||||||          ||| ||| ||| ||| ||||| |||                
..RLTI.ETNLLSI..EGGKRGLME..........EDM.ELA.RTL.KIA.LTENE.AEL                
--------10--------20--------30--------40--------50--------60

Total number of restraints: 40
Potential type of restraints: undefined (40)
Range of observed RDC values: 100.0, -100.0 (Hz)
RDC restraints per residue
- Chain_ID: A
  None

Saveframe: CNS/XPLOR_dipolar_coupling_5

Status: OK
Experiment type: .

Sequence coverage of experimental data

Entity_assembly_ID: A, Chain length: 76, Sequence coverage: 51.3%

--------10--------20--------30--------40--------50--------60--------70------
MIRLTIEETNLLSIYNEGGKRGLMENINAALPFMDEDMRELAKRTLAKIAPLTENEYAELAIFAADEVLEHHHHHH
  |||| |||||||  |||||||||          ||| ||| ||| |||  |||| |||                
..RLTI.ETNLLSI..EGGKRGLME..........EDM.ELA.RTL.KIA..TENE.AEL                
--------10--------20--------30--------40--------50--------60

Total number of restraints: 39
Potential type of restraints: undefined (39)
Range of observed RDC values: 100.0, -100.0 (Hz)
RDC restraints per residue
- Chain_ID: A
  None

Keywords NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-2, Protein NMR, Protein Structure Initiative, Structural Genomics, Target CfR130

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.861 seconds)

BMRB: 17359

Sample #1

Sample #2

Sample #3

Sample #4

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. CfR130, : 1 : 4 entities Detail

Experiments performed 15 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 6 contents Detail