A protein from yeast
SADDRLNFGD RILVKAPGYP WWPALLLRRK ETKDSLNTNS SFNVLYKVLF FPDFNFAWVK RNSVKPLLDS EIAKFLGSSK RKSKELIEAY EASKTPPDLK EESSTDLESA DDRLNFGDRI LVKAPGYPWW PALLLRRKET KDSLNTNSSF NVLYKVLFFP DFNFAWVKRN SVKPLLDSEI AKFLGSSKRK SKELIEAYEA SKTPPDLKEE SSTDLE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 47.7 % (1260 of 2644) | 48.8 % (677 of 1388) | 44.4 % (460 of 1036) | 55.9 % (123 of 220) |
Backbone | 56.2 % (712 of 1268) | 57.3 % (243 of 424) | 55.3 % (355 of 642) | 56.4 % (114 of 202) |
Sidechain | 42.0 % (666 of 1586) | 45.0 % (434 of 964) | 36.9 % (223 of 604) | 50.0 % (9 of 18) |
Aromatic | 29.2 % (76 of 260) | 49.2 % (64 of 130) | 7.3 % (9 of 124) | 50.0 % (3 of 6) |
Methyl | 49.5 % (109 of 220) | 44.5 % (49 of 110) | 54.5 % (60 of 110) |
1. A protein from fission yeast
SADDRLNFGD RILVKAPGYP WWPALLLRRK ETKDSLNTNS SFNVLYKVLF FPDFNFAWVK RNSVKPLLDS EIAKFLGSSK RKSKELIEAY EASKTPPDLK EESSTDLESA DDRLNFGDRI LVKAPGYPWW PALLLRRKET KDSLNTNSSF NVLYKVLFFP DFNFAWVKRN SVKPLLDSEI AKFLGSSKRK SKELIEAYEA SKTPPDLKEE SSTDLESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | a protein from fission yeast | 0.6 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | a protein from fission yeast | 0.6 mM | ||
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | EDTA | natural abundance | 2 mM | |
11 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | a protein from fission yeast | 0.6 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | a protein from fission yeast | 0.6 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | a protein from fission yeast | 0.6 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | a protein from fission yeast | 0.6 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | a protein from fission yeast | 0.6 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | a protein from fission yeast | 0.6 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | a protein from fission yeast | 0.6 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | a protein from fission yeast | 0.6 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | a protein from fission yeast | 0.6 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | a protein from fission yeast | 0.6 mM | ||
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | EDTA | natural abundance | 2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | a protein from fission yeast | 0.6 mM | ||
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | EDTA | natural abundance | 2 mM | |
11 | D2O | natural abundance | 100 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | a protein from fission yeast | 0.6 mM | ||
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | EDTA | natural abundance | 2 mM | |
11 | D2O | natural abundance | 100 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | a protein from fission yeast | 0.6 mM | ||
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | EDTA | natural abundance | 2 mM | |
11 | D2O | natural abundance | 100 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | a protein from fission yeast | 0.6 mM | ||
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | EDTA | natural abundance | 2 mM | |
11 | D2O | natural abundance | 100 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | a protein from fission yeast | 0.6 mM | ||
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | EDTA | natural abundance | 2 mM | |
11 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17398_2l89.nef |
Input source #2: Coordindates | 2l89.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
----50--------60--------70--------80--------90-------100-------110-------120-------130-------140---- SADDRLNFGDRILVKAPGYPWWPALLLRRKETKDSLNTNSSFNVLYKVLFFPDFNFAWVKRNSVKPLLDSEIAKFLGSSKRKSKELIEAYEASKTPPDLK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SADDRLNFGDRILVKAPGYPWWPALLLRRKETKDSLNTNSSFNVLYKVLFFPDFNFAWVKRNSVKPLLDSEIAKFLGSSKRKSKELIEAYEASKTPPDLK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ---150-- EESSTDLE |||||||| EESSTDLE --------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 108 | 0 | 0 | 100.0 |
Content subtype: combined_17398_2l89.nef
Assigned chemical shifts
----50--------60--------70--------80--------90-------100-------110-------120-------130-------140---- SADDRLNFGDRILVKAPGYPWWPALLLRRKETKDSLNTNSSFNVLYKVLFFPDFNFAWVKRNSVKPLLDSEIAKFLGSSKRKSKELIEAYEASKTPPDLK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||| SADDRLNFGDRILVKAPGYPWWPALLLRRKETKDSLNTNSSFNVLYKVLFFPDFNFAWVKRNSVKPLLDSEIAKFLGSSKRKSKELIEAYEASKT.PDLK ----50--------60--------70--------80--------90-------100-------110-------120-------130-------140---- ---150-- EESSTDLE |||||| EESSTD ---150
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
90 | TYR | HH | 8.343 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 694 | 588 | 84.7 |
13C chemical shifts | 518 | 379 | 73.2 |
15N chemical shifts | 116 | 105 | 90.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 212 | 204 | 96.2 |
13C chemical shifts | 216 | 198 | 91.7 |
15N chemical shifts | 101 | 96 | 95.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 482 | 384 | 79.7 |
13C chemical shifts | 302 | 181 | 59.9 |
15N chemical shifts | 15 | 9 | 60.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 55 | 36 | 65.5 |
13C chemical shifts | 55 | 47 | 85.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 65 | 59 | 90.8 |
13C chemical shifts | 62 | 0 | 0.0 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
----50--------60--------70--------80--------90-------100-------110-------120-------130-------140---- SADDRLNFGDRILVKAPGYPWWPALLLRRKETKDSLNTNSSFNVLYKVLFFPDFNFAWVKRNSVKPLLDSEIAKFLGSSKRKSKELIEAYEASKTPPDLK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||| SADDRLNFGDRILVKAPGYPWWPALLLRRKETKDSLNTNSSFNVLYKVLFFPDFNFAWVKRNSVKPLLDSEIAKFLGSSKRKSKELIEAYEASKT.PDLK ----50--------60--------70--------80--------90-------100-------110-------120-------130-------140---- ---150-- EESSTDLE |||||| EESSTD ---150
Dihedral angle restraints
----50--------60--------70--------80--------90-------100-------110-------120-------130-------140---- SADDRLNFGDRILVKAPGYPWWPALLLRRKETKDSLNTNSSFNVLYKVLFFPDFNFAWVKRNSVKPLLDSEIAKFLGSSKRKSKELIEAYEASKTPPDLK ||||||||||| |||||||||||||| |||||||||| ||||| ||||||||||||||||||||||||||||||||| ......NFGDRILVKAP..PWWPALLLRRKETK........FNVLYKVLFF....FAWVK..SVKPLLDSEIAKFLGSSKRKSKELIEAYEASKT ----50--------60--------70--------80--------90-------100-------110-------120-------130--------- ---150-- EESSTDLE