IPSE/alpha-1
GADSCKYCLQ LYDETYERGS YIEVYKSVGS LSPPWTPGSV CVPFVNDTKR ERPYWYLFDN VNYTGRITGL GHGTCIDDFT KSGFKGISSI KRCIQTKDGK VECINQ
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.8 % (1191 of 1230) | 96.1 % (614 of 639) | 98.8 % (475 of 481) | 92.7 % (102 of 110) |
Backbone | 96.2 % (602 of 626) | 95.0 % (207 of 218) | 98.4 % (302 of 307) | 92.1 % (93 of 101) |
Sidechain | 97.7 % (683 of 699) | 96.7 % (407 of 421) | 99.3 % (267 of 269) | 100.0 % (9 of 9) |
Aromatic | 99.2 % (131 of 132) | 100.0 % (66 of 66) | 98.4 % (63 of 64) | 100.0 % (2 of 2) |
Methyl | 98.9 % (93 of 94) | 97.9 % (46 of 47) | 100.0 % (47 of 47) |
1. IPSE/alpha-1
GADSCKYCLQ LYDETYERGS YIEVYKSVGS LSPPWTPGSV CVPFVNDTKR ERPYWYLFDN VNYTGRITGL GHGTCIDDFT KSGFKGISSI KRCIQTKDGK VECINQSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IPSE/alpha-1 | [U-13C; U-15N] | 1 mM | |
2 | IPSE/alpha-1 | [U-10% 13C] | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Bruker Avance III - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IPSE/alpha-1 | [U-13C; U-15N] | 1 mM | |
2 | IPSE/alpha-1 | [U-10% 13C] | 1 mM |
Bruker Avance III - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IPSE/alpha-1 | [U-13C; U-15N] | 1 mM | |
2 | IPSE/alpha-1 | [U-10% 13C] | 1 mM |
Bruker Avance III - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IPSE/alpha-1 | [U-13C; U-15N] | 1 mM | |
2 | IPSE/alpha-1 | [U-10% 13C] | 1 mM |
Bruker Avance III - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IPSE/alpha-1 | [U-13C; U-15N] | 1 mM | |
2 | IPSE/alpha-1 | [U-10% 13C] | 1 mM |
Bruker Avance III - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IPSE/alpha-1 | [U-13C; U-15N] | 1 mM | |
2 | IPSE/alpha-1 | [U-10% 13C] | 1 mM |
Bruker Avance III - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IPSE/alpha-1 | [U-13C; U-15N] | 1 mM | |
2 | IPSE/alpha-1 | [U-10% 13C] | 1 mM |
Bruker Avance III - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IPSE/alpha-1 | [U-13C; U-15N] | 1 mM | |
2 | IPSE/alpha-1 | [U-10% 13C] | 1 mM |
Bruker Avance III - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IPSE/alpha-1 | [U-13C; U-15N] | 1 mM | |
2 | IPSE/alpha-1 | [U-10% 13C] | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17405_4aka.nef |
Input source #2: Coordindates | 4aka.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
A:23:CYS:SG | A:26:CYS:SG | unknown, CA 57.143 ppm | oxidized, CA 55.136, CB 41.156 ppm | 2.035 |
A:59:CYS:SG | A:93:CYS:SG | oxidized, CA 56.187, CB 50.093 ppm | oxidized, CA 56.055, CB 48.727 ppm | 2.029 |
A:111:CYS:SG | A:121:CYS:SG | oxidized, CA 55.686, CB 49.266 ppm | oxidized, CA 53.809, CB 44.763 ppm | 2.021 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-20-------30--------40--------50--------60--------70--------80--------90-------100-------110-------1 GADSCKYCLQLYDETYERGSYIEVYKSVGSLSPPWTPGSVCVPFVNDTKRERPYWYLFDNVNYTGRITGLGHGTCIDDFTKSGFKGISSIKRCIQTKDGK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GADSCKYCLQLYDETYERGSYIEVYKSVGSLSPPWTPGSVCVPFVNDTKRERPYWYLFDNVNYTGRITGLGHGTCIDDFTKSGFKGISSIKRCIQTKDGK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 20---- VECINQ |||||| VECINQ ------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 106 | 0 | 0 | 100.0 |
Content subtype: combined_17405_4aka.nef
Assigned chemical shifts
-20-------30--------40--------50--------60--------70--------80--------90-------100-------110-------1 GADSCKYCLQLYDETYERGSYIEVYKSVGSLSPPWTPGSVCVPFVNDTKRERPYWYLFDNVNYTGRITGLGHGTCIDDFTKSGFKGISSIKRCIQTKDGK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GADSCKYCLQLYDETYERGSYIEVYKSVGSLSPPWTPGSVCVPFVNDTKRERPYWYLFDNVNYTGRITGLGHGTCIDDFTKSGFKGISSIKRCIQTKDGK 20---- VECINQ |||||| VECINQ
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
57 | SER | HG | 5.119 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 639 | 621 | 97.2 |
13C chemical shifts | 481 | 475 | 98.8 |
15N chemical shifts | 115 | 102 | 88.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 218 | 210 | 96.3 |
13C chemical shifts | 212 | 208 | 98.1 |
15N chemical shifts | 101 | 93 | 92.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 421 | 411 | 97.6 |
13C chemical shifts | 269 | 267 | 99.3 |
15N chemical shifts | 14 | 9 | 64.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 47 | 47 | 100.0 |
13C chemical shifts | 47 | 47 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 66 | 66 | 100.0 |
13C chemical shifts | 64 | 63 | 98.4 |
15N chemical shifts | 2 | 2 | 100.0 |
Covalent bonds
Distance restraints
-20-------30--------40--------50--------60--------70--------80--------90-------100-------110-------1 GADSCKYCLQLYDETYERGSYIEVYKSVGSLSPPWTPGSVCVPFVNDTKRERPYWYLFDNVNYTGRITGLGHGTCIDDFTKSGFKGISSIKRCIQTKDGK | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...S.KYCLQLYDETYERGSYIEVYKSVGSLSPPWTPGSVCVPFVNDTKRERPYWYLFDNVNYTGRITGLGHGTCIDDFTKSGFKGISSIKRCIQTKDGK 20---- VECINQ |||||| VECINQ
Dihedral angle restraints
-20-------30--------40--------50--------60--------70--------80--------90-------100-------110-------1 GADSCKYCLQLYDETYERGSYIEVYKSVGSLSPPWTPGSVCVPFVNDTKRERPYWYLFDNVNYTGRITGLGHGTCIDDFTKSGFKGISSIKRCIQTKDGK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .ADSCKYCLQLYDETYERGSYIEVYKSVGSLSPPWTPGSVCVPFVNDTKRERPYWYLFDNVNYTGRITGLGHGTCIDDFTKSGFKGISSIKRCIQTKDGK 20---- VECINQ |||||| VECINQ