GABARAPL-1 NBR1-LIR complex structure
GSPEFKFQYK EDHPFEYRKK EGEKIRKKYP DRVPVIVEKA PKARVPDLDK RKYLVPSDLT VGQFYFLIRK RIHLRPEDAL FFFVNNTIPP TSATMGQLYE DNHEEDYFLY VAYSDESVY
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 80.8 % (1360 of 1684) | 83.5 % (739 of 885) | 76.2 % (508 of 667) | 85.6 % (113 of 132) |
Backbone | 84.6 % (677 of 800) | 87.7 % (236 of 269) | 81.7 % (331 of 405) | 87.3 % (110 of 126) |
Sidechain | 78.3 % (795 of 1015) | 81.3 % (501 of 616) | 74.3 % (292 of 393) | 33.3 % (2 of 6) |
Aromatic | 57.4 % (109 of 190) | 76.8 % (73 of 95) | 37.9 % (36 of 95) | |
Methyl | 92.9 % (117 of 126) | 95.2 % (60 of 63) | 90.5 % (57 of 63) |
1. GABARAPL-1
GSPEFKFQYK EDHPFEYRKK EGEKIRKKYP DRVPVIVEKA PKARVPDLDK RKYLVPSDLT VGQFYFLIRK RIHLRPEDAL FFFVNNTIPP TSATMGQLYE DNHEEDYFLY VAYSDESVY2. NBR1-LIR
GAMGSASSED YIIILPESSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GABARAPL-1 | [U-98% 15N] | 0.6 (±0.05) mM | |
2 | NBR1-LIR | natural abundance | 0.9 (±0.05) mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 4.6 mM | |
6 | protease inhibitor cocktail | natural abundance | 1 mM | |
7 | DSS | natural abundance | 0.3 mM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | GABARAPL-1 | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
11 | NBR1-LIR | natural abundance | 0.9 (±0.05) mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 4.6 mM | |
15 | protease inhibitor cocktail | natural abundance | 1 mM | |
16 | DSS | natural abundance | 0.3 mM | |
17 | H2O | natural abundance | 95 % | |
18 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | GABARAPL-1 | natural abundance | 0.9 (±0.05) mM | |
20 | NBR1-LIR | [U-98% 15N] | 0.6 (±0.05) mM | |
21 | sodium phosphate | natural abundance | 50 mM | |
22 | sodium chloride | natural abundance | 100 mM | |
23 | sodium azide | natural abundance | 4.6 mM | |
24 | protease inhibitor cocktail | natural abundance | 1 mM | |
25 | DSS | natural abundance | 0.3 mM | |
26 | H2O | natural abundance | 95 % | |
27 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
28 | GABARAPL-1 | natural abundance | 0.9 (±0.05) mM | |
29 | NBR1-LIR | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
30 | sodium phosphate | natural abundance | 50 mM | |
31 | sodium chloride | natural abundance | 100 mM | |
32 | sodium azide | natural abundance | 4.6 mM | |
33 | protease inhibitor cocktail | natural abundance | 1 mM | |
34 | DSS | natural abundance | 0.3 mM | |
35 | H2O | natural abundance | 95 % | |
36 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GABARAPL-1 | [U-98% 15N] | 0.6 (±0.05) mM | |
2 | NBR1-LIR | natural abundance | 0.9 (±0.05) mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 4.6 mM | |
6 | protease inhibitor cocktail | natural abundance | 1 mM | |
7 | DSS | natural abundance | 0.3 mM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | GABARAPL-1 | natural abundance | 0.9 (±0.05) mM | |
20 | NBR1-LIR | [U-98% 15N] | 0.6 (±0.05) mM | |
21 | sodium phosphate | natural abundance | 50 mM | |
22 | sodium chloride | natural abundance | 100 mM | |
23 | sodium azide | natural abundance | 4.6 mM | |
24 | protease inhibitor cocktail | natural abundance | 1 mM | |
25 | DSS | natural abundance | 0.3 mM | |
26 | H2O | natural abundance | 95 % | |
27 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | GABARAPL-1 | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
11 | NBR1-LIR | natural abundance | 0.9 (±0.05) mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 4.6 mM | |
15 | protease inhibitor cocktail | natural abundance | 1 mM | |
16 | DSS | natural abundance | 0.3 mM | |
17 | H2O | natural abundance | 95 % | |
18 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
28 | GABARAPL-1 | natural abundance | 0.9 (±0.05) mM | |
29 | NBR1-LIR | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
30 | sodium phosphate | natural abundance | 50 mM | |
31 | sodium chloride | natural abundance | 100 mM | |
32 | sodium azide | natural abundance | 4.6 mM | |
33 | protease inhibitor cocktail | natural abundance | 1 mM | |
34 | DSS | natural abundance | 0.3 mM | |
35 | H2O | natural abundance | 95 % | |
36 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
28 | GABARAPL-1 | natural abundance | 0.9 (±0.05) mM | |
29 | NBR1-LIR | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
30 | sodium phosphate | natural abundance | 50 mM | |
31 | sodium chloride | natural abundance | 100 mM | |
32 | sodium azide | natural abundance | 4.6 mM | |
33 | protease inhibitor cocktail | natural abundance | 1 mM | |
34 | DSS | natural abundance | 0.3 mM | |
35 | H2O | natural abundance | 95 % | |
36 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
28 | GABARAPL-1 | natural abundance | 0.9 (±0.05) mM | |
29 | NBR1-LIR | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
30 | sodium phosphate | natural abundance | 50 mM | |
31 | sodium chloride | natural abundance | 100 mM | |
32 | sodium azide | natural abundance | 4.6 mM | |
33 | protease inhibitor cocktail | natural abundance | 1 mM | |
34 | DSS | natural abundance | 0.3 mM | |
35 | H2O | natural abundance | 95 % | |
36 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | GABARAPL-1 | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
11 | NBR1-LIR | natural abundance | 0.9 (±0.05) mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 4.6 mM | |
15 | protease inhibitor cocktail | natural abundance | 1 mM | |
16 | DSS | natural abundance | 0.3 mM | |
17 | H2O | natural abundance | 95 % | |
18 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | GABARAPL-1 | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
11 | NBR1-LIR | natural abundance | 0.9 (±0.05) mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 4.6 mM | |
15 | protease inhibitor cocktail | natural abundance | 1 mM | |
16 | DSS | natural abundance | 0.3 mM | |
17 | H2O | natural abundance | 95 % | |
18 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | GABARAPL-1 | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
11 | NBR1-LIR | natural abundance | 0.9 (±0.05) mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 4.6 mM | |
15 | protease inhibitor cocktail | natural abundance | 1 mM | |
16 | DSS | natural abundance | 0.3 mM | |
17 | H2O | natural abundance | 95 % | |
18 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | GABARAPL-1 | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
11 | NBR1-LIR | natural abundance | 0.9 (±0.05) mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 4.6 mM | |
15 | protease inhibitor cocktail | natural abundance | 1 mM | |
16 | DSS | natural abundance | 0.3 mM | |
17 | H2O | natural abundance | 95 % | |
18 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | GABARAPL-1 | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
11 | NBR1-LIR | natural abundance | 0.9 (±0.05) mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 4.6 mM | |
15 | protease inhibitor cocktail | natural abundance | 1 mM | |
16 | DSS | natural abundance | 0.3 mM | |
17 | H2O | natural abundance | 95 % | |
18 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | GABARAPL-1 | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
11 | NBR1-LIR | natural abundance | 0.9 (±0.05) mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 4.6 mM | |
15 | protease inhibitor cocktail | natural abundance | 1 mM | |
16 | DSS | natural abundance | 0.3 mM | |
17 | H2O | natural abundance | 95 % | |
18 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | GABARAPL-1 | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
11 | NBR1-LIR | natural abundance | 0.9 (±0.05) mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 4.6 mM | |
15 | protease inhibitor cocktail | natural abundance | 1 mM | |
16 | DSS | natural abundance | 0.3 mM | |
17 | H2O | natural abundance | 95 % | |
18 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | GABARAPL-1 | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
11 | NBR1-LIR | natural abundance | 0.9 (±0.05) mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 4.6 mM | |
15 | protease inhibitor cocktail | natural abundance | 1 mM | |
16 | DSS | natural abundance | 0.3 mM | |
17 | H2O | natural abundance | 95 % | |
18 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
28 | GABARAPL-1 | natural abundance | 0.9 (±0.05) mM | |
29 | NBR1-LIR | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
30 | sodium phosphate | natural abundance | 50 mM | |
31 | sodium chloride | natural abundance | 100 mM | |
32 | sodium azide | natural abundance | 4.6 mM | |
33 | protease inhibitor cocktail | natural abundance | 1 mM | |
34 | DSS | natural abundance | 0.3 mM | |
35 | H2O | natural abundance | 95 % | |
36 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
28 | GABARAPL-1 | natural abundance | 0.9 (±0.05) mM | |
29 | NBR1-LIR | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
30 | sodium phosphate | natural abundance | 50 mM | |
31 | sodium chloride | natural abundance | 100 mM | |
32 | sodium azide | natural abundance | 4.6 mM | |
33 | protease inhibitor cocktail | natural abundance | 1 mM | |
34 | DSS | natural abundance | 0.3 mM | |
35 | H2O | natural abundance | 95 % | |
36 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
28 | GABARAPL-1 | natural abundance | 0.9 (±0.05) mM | |
29 | NBR1-LIR | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
30 | sodium phosphate | natural abundance | 50 mM | |
31 | sodium chloride | natural abundance | 100 mM | |
32 | sodium azide | natural abundance | 4.6 mM | |
33 | protease inhibitor cocktail | natural abundance | 1 mM | |
34 | DSS | natural abundance | 0.3 mM | |
35 | H2O | natural abundance | 95 % | |
36 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
28 | GABARAPL-1 | natural abundance | 0.9 (±0.05) mM | |
29 | NBR1-LIR | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
30 | sodium phosphate | natural abundance | 50 mM | |
31 | sodium chloride | natural abundance | 100 mM | |
32 | sodium azide | natural abundance | 4.6 mM | |
33 | protease inhibitor cocktail | natural abundance | 1 mM | |
34 | DSS | natural abundance | 0.3 mM | |
35 | H2O | natural abundance | 95 % | |
36 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
28 | GABARAPL-1 | natural abundance | 0.9 (±0.05) mM | |
29 | NBR1-LIR | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
30 | sodium phosphate | natural abundance | 50 mM | |
31 | sodium chloride | natural abundance | 100 mM | |
32 | sodium azide | natural abundance | 4.6 mM | |
33 | protease inhibitor cocktail | natural abundance | 1 mM | |
34 | DSS | natural abundance | 0.3 mM | |
35 | H2O | natural abundance | 95 % | |
36 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
28 | GABARAPL-1 | natural abundance | 0.9 (±0.05) mM | |
29 | NBR1-LIR | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
30 | sodium phosphate | natural abundance | 50 mM | |
31 | sodium chloride | natural abundance | 100 mM | |
32 | sodium azide | natural abundance | 4.6 mM | |
33 | protease inhibitor cocktail | natural abundance | 1 mM | |
34 | DSS | natural abundance | 0.3 mM | |
35 | H2O | natural abundance | 95 % | |
36 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
28 | GABARAPL-1 | natural abundance | 0.9 (±0.05) mM | |
29 | NBR1-LIR | [U-98% 13C; U-98% 15N] | 0.6 (±0.05) mM | |
30 | sodium phosphate | natural abundance | 50 mM | |
31 | sodium chloride | natural abundance | 100 mM | |
32 | sodium azide | natural abundance | 4.6 mM | |
33 | protease inhibitor cocktail | natural abundance | 1 mM | |
34 | DSS | natural abundance | 0.3 mM | |
35 | H2O | natural abundance | 95 % | |
36 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17412_2l8j.nef |
Input source #2: Coordindates | 2l8j.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ GSPEFKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSPEFKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -100-------110----- DNHEEDYFLYVAYSDESVY ||||||||||||||||||| DNHEEDYFLYVAYSDESVY -------110---------
------730--------- GAMGSASSEDYIIILPES |||||||||||||||||| GAMGSASSEDYIIILPES --------10--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 119 | 0 | 0 | 100.0 |
B | B | 18 | 0 | 0 | 100.0 |
Content subtype: combined_17412_2l8j.nef
Assigned chemical shifts
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ GSPEFKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYE ||||| | | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..PEFKF.Y...H.FEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYE -100-------110----- DNHEEDYFLYVAYSDESVY ||||||||||||||||||| DNHEEDYFLYVAYSDESVY
------730--------- GAMGSASSEDYIIILPES |||||||||||||||||| GAMGSASSEDYIIILPES
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 791 | 663 | 83.8 |
13C chemical shifts | 593 | 453 | 76.4 |
15N chemical shifts | 123 | 93 | 75.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 232 | 208 | 89.7 |
13C chemical shifts | 238 | 195 | 81.9 |
15N chemical shifts | 109 | 93 | 85.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 559 | 455 | 81.4 |
13C chemical shifts | 355 | 258 | 72.7 |
15N chemical shifts | 14 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 52 | 96.3 |
13C chemical shifts | 54 | 49 | 90.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 91 | 70 | 76.9 |
13C chemical shifts | 91 | 34 | 37.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 94 | 91 | 96.8 |
13C chemical shifts | 74 | 53 | 71.6 |
15N chemical shifts | 17 | 17 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 37 | 36 | 97.3 |
13C chemical shifts | 36 | 18 | 50.0 |
15N chemical shifts | 17 | 17 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 57 | 55 | 96.5 |
13C chemical shifts | 38 | 35 | 92.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 11 | 11 | 100.0 |
13C chemical shifts | 11 | 11 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 4 | 4 | 100.0 |
13C chemical shifts | 4 | 2 | 50.0 |
Distance restraints
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ GSPEFKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYE |||| |||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| ...EFKF.......FEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDK.KYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYE -100-------110----- DNHEEDYFLYVAYSDESVY ||||||||||||||||||| DNHEEDYFLYVAYSDESVY
------730--------- GAMGSASSEDYIIILPES |||||||||||||||| ..MGSASSEDYIIILPES
Dihedral angle restraints
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ GSPEFKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||| |||||| .....KFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTI.PTSA.MGQLYE -100-------110----- DNHEEDYFLYVAYSDESVY ||||||||||||||||||| DNHEEDYFLYVAYSDESVY
------730--------- GAMGSASSEDYIIILPES |||||||||||||||||| GAMGSASSEDYIIILPES