Solution structure of the protein YP_546394.1, the first structural representative of the pfam family PF12112
GMGTTEKSGI KEIIIQGLTR AGKPFRPSDW VDRMCSTYAS FGADRKLRYS PYLKPRVIEG VRCLAVDLKL KDTNPEGFNQ LMHFATENQL NILDAEGNSI DAAQVTEI
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 98.2 % (1226 of 1249) | 98.0 % (639 of 652) | 98.1 % (475 of 484) | 99.1 % (112 of 113) |
Backbone | 98.6 % (629 of 638) | 98.6 % (217 of 220) | 98.4 % (310 of 315) | 99.0 % (102 of 103) |
Sidechain | 98.0 % (696 of 710) | 97.7 % (422 of 432) | 98.5 % (264 of 268) | 100.0 % (10 of 10) |
Aromatic | 100.0 % (80 of 80) | 100.0 % (40 of 40) | 100.0 % (39 of 39) | 100.0 % (1 of 1) |
Methyl | 100.0 % (118 of 118) | 100.0 % (59 of 59) | 100.0 % (59 of 59) |
1. YP 546394.1
GMGTTEKSGI KEIIIQGLTR AGKPFRPSDW VDRMCSTYAS FGADRKLRYS PYLKPRVIEG VRCLAVDLKL KDTNPEGFNQ LMHFATENQL NILDAEGNSI DAAQVTEISolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 50 mM sodium chloride, 20mM sodium phosphate, 4.5 mM sodium azide, 1.2 mM [U-98% 13C, U-98% 15N]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_546394.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 4.5 mM | |
5 | H20 | natural abundance | 95 % | |
6 | D20 | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 50 mM sodium chloride, 20mM sodium phosphate, 4.5 mM sodium azide, 1.2 mM [U-98% 13C, U-98% 15N]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_546394.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 4.5 mM | |
5 | H20 | natural abundance | 95 % | |
6 | D20 | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 50 mM sodium chloride, 20mM sodium phosphate, 4.5 mM sodium azide, 1.2 mM [U-98% 13C, U-98% 15N]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_546394.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 4.5 mM | |
5 | H20 | natural abundance | 95 % | |
6 | D20 | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 50 mM sodium chloride, 20mM sodium phosphate, 4.5 mM sodium azide, 1.2 mM [U-98% 13C, U-98% 15N]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_546394.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 4.5 mM | |
5 | H20 | natural abundance | 95 % | |
6 | D20 | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 50 mM sodium chloride, 20mM sodium phosphate, 4.5 mM sodium azide, 1.2 mM [U-98% 13C, U-98% 15N]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_546394.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 4.5 mM | |
5 | H20 | natural abundance | 95 % | |
6 | D20 | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 50 mM sodium chloride, 20mM sodium phosphate, 4.5 mM sodium azide, 1.2 mM [U-98% 13C, U-98% 15N]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_546394.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 4.5 mM | |
5 | H20 | natural abundance | 95 % | |
6 | D20 | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 50 mM sodium chloride, 20mM sodium phosphate, 4.5 mM sodium azide, 1.2 mM [U-98% 13C, U-98% 15N]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_546394.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 4.5 mM | |
5 | H20 | natural abundance | 95 % | |
6 | D20 | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 50 mM sodium chloride, 20mM sodium phosphate, 4.5 mM sodium azide, 1.2 mM [U-98% 13C, U-98% 15N]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_546394.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 4.5 mM | |
5 | H20 | natural abundance | 95 % | |
6 | D20 | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 50 mM sodium chloride, 20mM sodium phosphate, 4.5 mM sodium azide, 1.2 mM [U-98% 13C, U-98% 15N]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_546394.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 4.5 mM | |
5 | H20 | natural abundance | 95 % | |
6 | D20 | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17448_2l9d.nef |
Input source #2: Coordindates | 2l9d.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GMGTTEKSGIKEIIIQGLTRAGKPFRPSDWVDRMCSTYASFGADRKLRYSPYLKPRVIEGVRCLAVDLKLKDTNPEGFNQLMHFATENQLNILDAEGNSI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GMGTTEKSGIKEIIIQGLTRAGKPFRPSDWVDRMCSTYASFGADRKLRYSPYLKPRVIEGVRCLAVDLKLKDTNPEGFNQLMHFATENQLNILDAEGNSI -------- DAAQVTEI |||||||| DAAQVTEI
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 108 | 0 | 0 | 100.0 |
Content subtype: combined_17448_2l9d.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GMGTTEKSGIKEIIIQGLTRAGKPFRPSDWVDRMCSTYASFGADRKLRYSPYLKPRVIEGVRCLAVDLKLKDTNPEGFNQLMHFATENQLNILDAEGNSI ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .MGTTEKSGIKEIIIQGLTRAGKPFRPSDWVDRMCSTYASFGADRKLRYSPYLKPRVIEGVRCLAVDLKLKDTNPEGFNQLMHFATENQLNILDAEGNSI -------- DAAQVTEI |||||||| DAAQVTEI
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 652 | 639 | 98.0 |
13C chemical shifts | 484 | 471 | 97.3 |
15N chemical shifts | 120 | 117 | 97.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 220 | 216 | 98.2 |
13C chemical shifts | 216 | 207 | 95.8 |
15N chemical shifts | 103 | 101 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 432 | 423 | 97.9 |
13C chemical shifts | 268 | 264 | 98.5 |
15N chemical shifts | 17 | 16 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 62 | 61 | 98.4 |
13C chemical shifts | 62 | 61 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 40 | 40 | 100.0 |
13C chemical shifts | 39 | 39 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GMGTTEKSGIKEIIIQGLTRAGKPFRPSDWVDRMCSTYASFGADRKLRYSPYLKPRVIEGVRCLAVDLKLKDTNPEGFNQLMHFATENQLNILDAEGNSI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..GTTEKSGIKEIIIQGLTRAGKPFRPSDWVDRMCSTYASFGADRKLRYSPYLKPRVIEGVRCLAVDLKLKDTNPEGFNQLMHFATENQLNILDAEGNSI -------- DAAQVTEI |||||||| DAAQVTEI
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GMGTTEKSGIKEIIIQGLTRAGKPFRPSDWVDRMCSTYASFGADRKLRYSPYLKPRVIEGVRCLAVDLKLKDTNPEGFNQLMHFATENQLNILDAEGNSI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GMGTTEKSGIKEIIIQGLTRAGKPFRPSDWVDRMCSTYASFGADRKLRYSPYLKPRVIEGVRCLAVDLKLKDTNPEGFNQLMHFATENQLNILDAEGNSI -------- DAAQVTEI |||||||| DAAQVTEI