1H, 15N, 13C chemical shift assignment of the THAP domain 1-81 from the cell growth suppressor human THAP11 protein
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | na | sing | 1:CYS7:SG | 2:ZN1:ZN |
2 | na | sing | 1:CYS12:SG | 2:ZN1:ZN |
3 | na | sing | 1:CYS62:SG | 2:ZN1:ZN |
4 | na | sing | 1:HIS65:NE2 | 2:ZN1:ZN |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.4 % (880 of 942) | 94.1 % (459 of 488) | 92.7 % (345 of 372) | 92.7 % (76 of 82) |
Backbone | 93.9 % (447 of 476) | 96.4 % (159 of 165) | 92.8 % (218 of 235) | 92.1 % (70 of 76) |
Sidechain | 93.7 % (505 of 539) | 92.9 % (300 of 323) | 94.8 % (199 of 210) | 100.0 % (6 of 6) |
Aromatic | 86.1 % (105 of 122) | 86.9 % (53 of 61) | 85.0 % (51 of 60) | 100.0 % (1 of 1) |
Methyl | 100.0 % (70 of 70) | 100.0 % (35 of 35) | 100.0 % (35 of 35) |
1. THAP domain
GSPGFTCCVP GCYNNSHRDK ALHFYTFPKD AELRRLWLKN VSRAGVSGCF STFQPTTGHR LCSVHFQGGR KTYTVRVPTI FSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | THAP domain | natural abundance | 0,7 mM | |
6 | Tris-HCl | natural abundance | 50 mM | |
7 | sodium chloride | natural abundance | 30 mM | |
8 | DTT | natural abundance | 5 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | THAP domain | [U-99% 15N] | 0,7 mM | |
10 | Tris-HCl | natural abundance | 50 mM | |
11 | sodium chloride | natural abundance | 30 mM | |
12 | DTT | natural abundance | 5 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | THAP domain | [U-99% 13C; U-99% 15N] | 0,5 mM | |
2 | Tris-HCl | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 5 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_17456_2lau.nef |
Input source #2: Coordindates | 2lau.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:65:HIS:NE2 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:62:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:7:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:12:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | ZN | ZINC ION | None |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80- GSPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIF ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIF
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 81 | 0 | 0 | 100.0 |
Content subtype: combined_17456_2lau.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80- GSPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIF ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..PGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIF
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
65 | HIS | HD1 | 11.29 |
65 | HIS | ND1 | 127.022 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 488 | 459 | 94.1 |
13C chemical shifts | 372 | 342 | 91.9 |
15N chemical shifts | 89 | 75 | 84.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 165 | 157 | 95.2 |
13C chemical shifts | 162 | 143 | 88.3 |
15N chemical shifts | 76 | 69 | 90.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 323 | 302 | 93.5 |
13C chemical shifts | 210 | 199 | 94.8 |
15N chemical shifts | 13 | 6 | 46.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 35 | 35 | 100.0 |
13C chemical shifts | 35 | 35 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 53 | 86.9 |
13C chemical shifts | 60 | 51 | 85.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80- GSPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIF ||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..PGFTCCVPG.YNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIF