NMR Structure of the Mouse MFG-E8 C2 Domain
MKSGHGCSEP LGLKNNTIPD SQMSASSSYK TWNLRAFGWY PHLGRLDNQG KINAWTAQSN SAKEWLQVDL GTQRQVTGII TQGARDFGHI QYVASYKVAH SDDGVQWTVY EEQGSSKVFQ GNLDNNSHKK NIFEKPFMAR YVRVLPVSWH NRITLRLELL GCLEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 78.9 % (1583 of 2006) | 80.1 % (835 of 1043) | 75.6 % (582 of 770) | 86.0 % (166 of 193) |
Backbone | 91.8 % (927 of 1010) | 92.8 % (324 of 349) | 90.7 % (450 of 496) | 92.7 % (153 of 165) |
Sidechain | 69.4 % (800 of 1152) | 73.6 % (511 of 694) | 64.2 % (276 of 430) | 46.4 % (13 of 28) |
Aromatic | 11.0 % (24 of 218) | 18.3 % (20 of 109) | 0.0 % (0 of 103) | 66.7 % (4 of 6) |
Methyl | 93.0 % (147 of 158) | 97.5 % (77 of 79) | 88.6 % (70 of 79) |
1. MFG-E8 C2 domain
MKSGHGCSEP LGLKNNTIPD SQMSASSSYK TWNLRAFGWY PHLGRLDNQG KINAWTAQSN SAKEWLQVDL GTQRQVTGII TQGARDFGHI QYVASYKVAH SDDGVQWTVY EEQGSSKVFQ GNLDNNSHKK NIFEKPFMAR YVRVLPVSWH NRITLRLELL GCLEHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.01 % | |
4 | MFG-E8 C2 domain | [U-13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 20 mM | |
9 | sodium azide | natural abundance | 0.01 % | |
10 | MFG-E8 C2 domain | [U-13C; U-15N] | 0.8 mM | |
11 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.01 % | |
4 | MFG-E8 C2 domain | [U-13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.01 % | |
4 | MFG-E8 C2 domain | [U-13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.01 % | |
4 | MFG-E8 C2 domain | [U-13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.01 % | |
4 | MFG-E8 C2 domain | [U-13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.01 % | |
4 | MFG-E8 C2 domain | [U-13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.01 % | |
4 | MFG-E8 C2 domain | [U-13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.01 % | |
4 | MFG-E8 C2 domain | [U-13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 20 mM | |
9 | sodium azide | natural abundance | 0.01 % | |
10 | MFG-E8 C2 domain | [U-13C; U-15N] | 0.8 mM | |
11 | D2O | natural abundance | 100 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 0.01 % | |
4 | MFG-E8 C2 domain | [U-13C; U-15N] | 0.8 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 20 mM | |
9 | sodium azide | natural abundance | 0.01 % | |
10 | MFG-E8 C2 domain | [U-13C; U-15N] | 0.8 mM | |
11 | D2O | natural abundance | 100 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 20 mM | |
9 | sodium azide | natural abundance | 0.01 % | |
10 | MFG-E8 C2 domain | [U-13C; U-15N] | 0.8 mM | |
11 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17477_2l9l.nef |
Input source #2: Coordindates | 2l9l.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:1:CYS:SG | A:156:CYS:SG | oxidized, CA 53.315, CB 42.748 ppm | oxidized, CA 52.123, CB 39.08 ppm | 2.026 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------------10--------20--------30--------40--------50--------60--------70--------80--------90---- MKSGHGCSEPLGLKNNTIPDSQMSASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MKSGHGCSEPLGLKNNTIPDSQMSASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAH --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ---100-------110-------120-------130-------140-------150-------160---- SDDGVQWTVYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRLELLGCLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SDDGVQWTVYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRLELLGCLEHHHHHH -------110-------120-------130-------140-------150-------160-------170
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 170 | 0 | 0 | 100.0 |
Content subtype: combined_17477_2l9l.nef
Assigned chemical shifts
--------------10--------20--------30--------40--------50--------60--------70--------80--------90---- MKSGHGCSEPLGLKNNTIPDSQMSASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAH |||||||||||||||||||||||||||| |||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..SGHGCSEPLGLKNNTIPDSQMSASSSYK.....AFGW.PHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAH --------------10--------20--------30--------40--------50--------60--------70--------80--------90---- ---100-------110-------120-------130-------140-------150-------160---- SDDGVQWTVYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRLELLGCLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SDDGVQWTVYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRLELLGCLE ---100-------110-------120-------130-------140-------150--------
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
86 | TYR | HH | 8.886 |
122 | HIS | HD1 | 6.658 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1043 | 819 | 78.5 |
13C chemical shifts | 770 | 573 | 74.4 |
15N chemical shifts | 201 | 160 | 79.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 349 | 319 | 91.4 |
13C chemical shifts | 340 | 304 | 89.4 |
15N chemical shifts | 165 | 149 | 90.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 694 | 500 | 72.0 |
13C chemical shifts | 430 | 269 | 62.6 |
15N chemical shifts | 36 | 11 | 30.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 76 | 92.7 |
13C chemical shifts | 82 | 71 | 86.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 109 | 20 | 18.3 |
13C chemical shifts | 103 | 0 | 0.0 |
15N chemical shifts | 6 | 4 | 66.7 |
Covalent bonds
Distance restraints
--------------10--------20--------30--------40--------50--------60--------70--------80--------90---- MKSGHGCSEPLGLKNNTIPDSQMSASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAH |||||||||||||||||||||||| ||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......CSEPLGLKNNTIPDSQMSASSSYK.....AFG..PHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAH --------------10--------20--------30--------40--------50--------60--------70--------80--------90---- ---100-------110-------120-------130-------140-------150-------160---- SDDGVQWTVYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRLELLGCLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SDDGVQWTVYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRLELLGCLE ---100-------110-------120-------130-------140-------150--------
Dihedral angle restraints
--------------10--------20--------30--------40--------50--------60--------70--------80--------90---- MKSGHGCSEPLGLKNNTIPDSQMSASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAH ||||| || |||| |||| ||| ||| ||||||| |||| ||| ||||||||||||| |||||||| ||||||| ||||| ...GHGCS.PL.....TIPD...SASS.YKT......GWY...GRLDNQG...AWTA..NSA..WLQVDLGTQRQVT.IITQGARD.GHIQYVA.YKVAH --------------10--------20--------30--------40--------50--------60--------70--------80--------90---- ---100-------110-------120-------130-------140-------150-------160---- SDDGVQWTVYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLRLELLGCLEHHHHHH |||||||||||| |||||| |||| |||| ||||||||||| || |||||||||| SDDGVQWTVYEE.GSSKVF.....NNSH.KNIF...FMARYVRVLPV....RI.LRLELLGCLE ---100-------110-------120-------130-------140-------150--------