Solution NMR Structure of Q5HLI9 from Staphylococcus epidermidis, Northeast Structural Genomics Consortium Target SeR147
MTIEKKKNKI IFTRTFSAPI NKVFDAYTKR ELFEQWFHPQ DASVTVYDFN ATKGGSAFYA IQAPQMISYT IAEYLQVDAP YYIEYLDYFA TSKGEKDTSM PGMHITLNFE EVKGKTTVTS TSTFPTESAA QQAIDMGVET GMNSTLNQLE KLLNQKLEHH HHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.4 % (1704 of 1950) | 88.9 % (894 of 1006) | 84.7 % (651 of 769) | 90.9 % (159 of 175) |
Backbone | 91.0 % (885 of 972) | 91.5 % (301 of 329) | 91.1 % (442 of 485) | 89.9 % (142 of 158) |
Sidechain | 85.1 % (966 of 1135) | 87.6 % (593 of 677) | 80.7 % (356 of 441) | 100.0 % (17 of 17) |
Aromatic | 55.6 % (120 of 216) | 69.4 % (75 of 108) | 41.1 % (44 of 107) | 100.0 % (1 of 1) |
Methyl | 97.6 % (162 of 166) | 97.6 % (81 of 83) | 97.6 % (81 of 83) |
1. SeR147
MTIEKKKNKI IFTRTFSAPI NKVFDAYTKR ELFEQWFHPQ DASVTVYDFN ATKGGSAFYA IQAPQMISYT IAEYLQVDAP YYIEYLDYFA TSKGEKDTSM PGMHITLNFE EVKGKTTVTS TSTFPTESAA QQAIDMGVET GMNSTLNQLE KLLNQKLEHH HHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SeR147 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | SeR147 | [U-5% 13C; U-100% 15N] | 0.62 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 5 mM | |
11 | sodium azide | natural abundance | 0.02 % | |
12 | TRIS | natural abundance | 10 mM | |
13 | H2O | natural abundance | 95 % | |
14 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | SeR147 | [U-5% 13C; U-100% 15N] | 0.41 mM | |
16 | sodium chloride | natural abundance | 100 mM | |
17 | DTT | natural abundance | 5 mM | |
18 | sodium azide | natural abundance | 0.02 % | |
19 | TRIS | natural abundance | 10 mM | |
20 | phage | natural abundance | 13.2 mg/mL | |
21 | H2O | natural abundance | 95 % | |
22 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SeR147 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SeR147 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SeR147 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SeR147 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SeR147 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SeR147 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SeR147 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SeR147 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SeR147 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | SeR147 | [U-5% 13C; U-100% 15N] | 0.62 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 5 mM | |
11 | sodium azide | natural abundance | 0.02 % | |
12 | TRIS | natural abundance | 10 mM | |
13 | H2O | natural abundance | 95 % | |
14 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | SeR147 | [U-5% 13C; U-100% 15N] | 0.41 mM | |
16 | sodium chloride | natural abundance | 100 mM | |
17 | DTT | natural abundance | 5 mM | |
18 | sodium azide | natural abundance | 0.02 % | |
19 | TRIS | natural abundance | 10 mM | |
20 | phage | natural abundance | 13.2 mg/mL | |
21 | H2O | natural abundance | 95 % | |
22 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_17481_2l9p.nef |
Input source #2: Coordindates | 2l9p.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTIEKKKNKIIFTRTFSAPINKVFDAYTKRELFEQWFHPQDASVTVYDFNATKGGSAFYAIQAPQMISYTIAEYLQVDAPYYIEYLDYFATSKGEKDTSM |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTIEKKKNKIIFTRTFSAPINKVFDAYTKRELFEQWFHPQDASVTVYDFNATKGGSAFYAIQAPQMISYTIAEYLQVDAPYYIEYLDYFATSKGEKDTSM -------110-------120-------130-------140-------150-------160---- PGMHITLNFEEVKGKTTVTSTSTFPTESAAQQAIDMGVETGMNSTLNQLEKLLNQKLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| PGMHITLNFEEVKGKTTVTSTSTFPTESAAQQAIDMGVETGMNSTLNQLEKLLNQKLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 164 | 0 | 0 | 100.0 |
Content subtype: combined_17481_2l9p.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTIEKKKNKIIFTRTFSAPINKVFDAYTKRELFEQWFHPQDASVTVYDFNATKGGSAFYAIQAPQMISYTIAEYLQVDAPYYIEYLDYFATSKGEKDTSM |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..IEKKKNKIIFTRTFSAPINKVFDAYTKRELFEQWFHPQDASVTVYDFNATKGGSAFYAIQAPQMISYTIAEYLQVDAPYYIEYLDYFATSKGEKDTSM --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160---- PGMHITLNFEEVKGKTTVTSTSTFPTESAAQQAIDMGVETGMNSTLNQLEKLLNQKLEHHHHHH ||||||||| |||||||||||||| |||||||||||||||||||||||||||||||| PGMHITLNF...KGKTTVTSTSTFPT.SAAQQAIDMGVETGMNSTLNQLEKLLNQKLEH -------110-------120-------130-------140-------150---------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1006 | 882 | 87.7 |
13C chemical shifts | 769 | 634 | 82.4 |
15N chemical shifts | 177 | 155 | 87.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 329 | 296 | 90.0 |
13C chemical shifts | 328 | 287 | 87.5 |
15N chemical shifts | 158 | 138 | 87.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 677 | 586 | 86.6 |
13C chemical shifts | 441 | 347 | 78.7 |
15N chemical shifts | 19 | 17 | 89.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 89 | 82 | 92.1 |
13C chemical shifts | 89 | 82 | 92.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 108 | 73 | 67.6 |
13C chemical shifts | 107 | 41 | 38.3 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTIEKKKNKIIFTRTFSAPINKVFDAYTKRELFEQWFHPQDASVTVYDFNATKGGSAFYAIQAPQMISYTIAEYLQVDAPYYIEYLDYFATSKGEKDTSM ||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..IEKKKNKIIFTRTFSAPINKVFDAYTKRELFEQWFHP.DASVTVYDFNATKGGSAFYAIQAPQMISYTIAEYLQVDAPYYIEYLDYFATSKGEKDTSM --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160---- PGMHITLNFEEVKGKTTVTSTSTFPTESAAQQAIDMGVETGMNSTLNQLEKLLNQKLEHHHHHH ||||||||| |||||||||||||| ||||||||||||||||||||||||||||||| PGMHITLNF...KGKTTVTSTSTFPT.SAAQQAIDMGVETGMNSTLNQLEKLLNQKLE -------110-------120-------130-------140-------150--------
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTIEKKKNKIIFTRTFSAPINKVFDAYTKRELFEQWFHPQDASVTVYDFNATKGGSAFYAIQAPQMISYTIAEYLQVDAPYYIEYLDYFATSKGEKDTSM ||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..IEKKKNKIIFTRTFSAPINKVFDAYTKRELFEQWFHP.DASVTVYDFNATKGGSAFYAIQAPQMISYTIAEYLQVDAPYYIEYLDYFATSKGEKDTSM --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160---- PGMHITLNFEEVKGKTTVTSTSTFPTESAAQQAIDMGVETGMNSTLNQLEKLLNQKLEHHHHHH ||||||||| |||||||||||||| ||||||||||||||||||||||||||||||| PGMHITLNF...KGKTTVTSTSTFPT.SAAQQAIDMGVETGMNSTLNQLEKLLNQKLE -------110-------120-------130-------140-------150--------
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTIEKKKNKIIFTRTFSAPINKVFDAYTKRELFEQWFHPQDASVTVYDFNATKGGSAFYAIQAPQMISYTIAEYLQVDAPYYIEYLDYFATSKGEKDTSM | ||||||||| | | |||||| | ||||||| | |||||||| | |||||| |||||||||||||||||||||||||||||||||| ..I....NKIIFTRTF.A.I..VFDAYT.R..FEQWFHP..A.VTVYDFNA.K..SAFYAI.....ISYTIAEYLQVDAPYYIEYLDYFATSKGEKDTSM --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160---- PGMHITLNFEEVKGKTTVTSTSTFPTESAAQQAIDMGVETGMNSTLNQLEKLLNQKLEHHHHHH |||||||| |||||||||||| |||||||||||||||||||||||||||| | .GMHITLNF.....KTTVTSTSTFPT.SAAQQAIDMGVETGMNSTLNQLEKLLNQ.L -------110-------120-------130-------140-------150-------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTIEKKKNKIIFTRTFSAPINKVFDAYTKRELFEQWFHPQDASVTVYDFNATKGGSAFYAIQAPQMISYTIAEYLQVDAPYYIEYLDYFATSKGEKDTSM ||||||||||||||||||||||||||||||||| |||||||||| ||||||||| ||||||||||||||| ||||||||||| ..IEKKKNKIIFTRTFSAPINKVFDAYTKRELFEQ......ASVTVYDFNA...GSAFYAIQA.QMISYTIAEYLQVDA.YYIEYLDYFAT......... --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160---- PGMHITLNFEEVKGKTTVTSTSTFPTESAAQQAIDMGVETGMNSTLNQLEKLLNQKLEHHHHHH |||||||| ||||||||||| |||||||||||||||||||||||||||| ..MHITLNFE...GKTTVTSTSTF...SAAQQAIDMGVETGMNSTLNQLEKLLNQ -------110-------120-------130-------140-------150-----
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTIEKKKNKIIFTRTFSAPINKVFDAYTKRELFEQWFHPQDASVTVYDFNATKGGSAFYAIQAPQMISYTIAEYLQVDAPYYIEYLDYFATSKGEKDTSM | | || | | | || | ||||| | || || || || |||| | | || |||||| | | ||| |||||| | ||| .....K.N.II.T..F.A....VF..Y.KRELF...F....AS..VY..NA.KG.SAFY.I.A.QM..YTIAEY.Q.D....IEY..YFATSK.E..TSM --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160---- PGMHITLNFEEVKGKTTVTSTSTFPTESAAQQAIDMGVETGMNSTLNQLEKLLNQKLEHHHHHH ||| | | |||| |||||| ||| |||||| || ||| || ...HIT.......G..T..STST.....AAQQAI.MGV.TGMNST.NQ.EKL.NQ -------110-------120-------130-------140-------150-----