Backbone and side-chain 1H, 15N, and 13C resonance assignments of Norwalk virus protease
MHHHHHHAPP TLWSRVTKFG SGWGFWVSPT VFITTTHVVP TGVKEFFGEP LSSIAIHQAG EFTQFRFSKK MRPDLTGMVL EEGCPEGTVC SVLIKRDSGE LLPLAVRMGA IASMRIQGRL VHGQSGMLLT GANAKGMDLG TIPGDCGAPY VHKRGNDWVV CGVHAAATKS GNTVVCAVQA GEGETALE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.9 % (1788 of 2082) | 86.1 % (918 of 1066) | 83.8 % (692 of 826) | 93.7 % (178 of 190) |
Backbone | 94.1 % (1043 of 1108) | 93.8 % (366 of 390) | 94.3 % (509 of 540) | 94.4 % (168 of 178) |
Sidechain | 78.6 % (895 of 1138) | 81.4 % (550 of 676) | 74.4 % (335 of 450) | 83.3 % (10 of 12) |
Aromatic | 28.9 % (52 of 180) | 46.7 % (42 of 90) | 7.0 % (6 of 86) | 100.0 % (4 of 4) |
Methyl | 92.5 % (196 of 212) | 91.5 % (97 of 106) | 93.4 % (99 of 106) |
1. NVpro
MHHHHHHAPP TLWSRVTKFG SGWGFWVSPT VFITTTHVVP TGVKEFFGEP LSSIAIHQAG EFTQFRFSKK MRPDLTGMVL EEGCPEGTVC SVLIKRDSGE LLPLAVRMGA IASMRIQGRL VHGQSGMLLT GANAKGMDLG TIPGDCGAPY VHKRGNDWVV CGVHAAATKS GNTVVCAVQA GEGETALESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NVpro | [U-99% 15N] | 0.7-0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 3 mM | |
5 | D2O | natural abundance | 5 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | sodium azide | natural abundance | 3 mM | |
10 | D2O | [U-99% 2H] | 5 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 3 mM | |
15 | D2O | natural abundance | 5 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | NVpro | [U-15N]-Val | 0.7 mM | |
17 | sodium phosphate | natural abundance | 20 mM | |
18 | sodium chloride | natural abundance | 100 mM | |
19 | sodium azide | natural abundance | 3 mM | |
20 | D2O | natural abundance | 5 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | NVpro | [U-15N]-Ala | 0.7 mM | |
22 | sodium phosphate | natural abundance | 20 mM | |
23 | sodium chloride | natural abundance | 100 mM | |
24 | sodium azide | natural abundance | 3 mM | |
25 | D2O | natural abundance | 5 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian UnityPlus - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NVpro | [U-99% 15N] | 0.7-0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 3 mM | |
5 | D2O | natural abundance | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | sodium azide | natural abundance | 3 mM | |
10 | D2O | [U-99% 2H] | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | sodium azide | natural abundance | 3 mM | |
10 | D2O | [U-99% 2H] | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | sodium azide | natural abundance | 3 mM | |
10 | D2O | [U-99% 2H] | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | sodium azide | natural abundance | 3 mM | |
10 | D2O | [U-99% 2H] | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | sodium azide | natural abundance | 3 mM | |
10 | D2O | [U-99% 2H] | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | sodium azide | natural abundance | 3 mM | |
10 | D2O | [U-99% 2H] | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | sodium azide | natural abundance | 3 mM | |
10 | D2O | [U-99% 2H] | 5 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | sodium azide | natural abundance | 3 mM | |
10 | D2O | [U-99% 2H] | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | sodium azide | natural abundance | 3 mM | |
10 | D2O | [U-99% 2H] | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | sodium azide | natural abundance | 3 mM | |
10 | D2O | [U-99% 2H] | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | sodium azide | natural abundance | 3 mM | |
10 | D2O | [U-99% 2H] | 5 mM |
Varian UnityPlus - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | sodium azide | natural abundance | 3 mM | |
10 | D2O | [U-99% 2H] | 5 mM |
Varian UnityPlus - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | sodium azide | natural abundance | 3 mM | |
10 | D2O | [U-99% 2H] | 5 mM |
Varian UnityPlus - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | sodium azide | natural abundance | 3 mM | |
10 | D2O | [U-99% 2H] | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 3 mM | |
15 | D2O | natural abundance | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | sodium azide | natural abundance | 3 mM | |
10 | D2O | [U-99% 2H] | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | sodium azide | natural abundance | 3 mM | |
10 | D2O | [U-99% 2H] | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NVpro | [U-99% 15N] | 0.7-0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 3 mM | |
5 | D2O | natural abundance | 5 mM |
Varian UnityPlus - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 3 mM | |
15 | D2O | natural abundance | 5 mM |
Varian UnityPlus - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | NVpro | [U-99% 13C; U-99% 15N] | 0.7-0.8 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 3 mM | |
15 | D2O | natural abundance | 5 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17523_2lnc.nef |
Input source #2: Coordindates | 2lnc.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MHHHHHHAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MHHHHHHAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGE -------110-------120-------130-------140-------150-------160-------170-------180-------- LLPLAVRMGAIASMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETALE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LLPLAVRMGAIASMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETALE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 188 | 0 | 0 | 100.0 |
Content subtype: combined_17523_2lnc.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MHHHHHHAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGE ||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....HHA.PTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGE -------110-------120-------130-------140-------150-------160-------170-------180-------- LLPLAVRMGAIASMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETALE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||| LLPLAVRMGAIASMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVC.VQAGEGETALE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1066 | 923 | 86.6 |
13C chemical shifts | 826 | 683 | 82.7 |
15N chemical shifts | 198 | 177 | 89.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 390 | 369 | 94.6 |
13C chemical shifts | 376 | 355 | 94.4 |
15N chemical shifts | 178 | 167 | 93.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 676 | 554 | 82.0 |
13C chemical shifts | 450 | 328 | 72.9 |
15N chemical shifts | 20 | 10 | 50.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 113 | 100 | 88.5 |
13C chemical shifts | 113 | 96 | 85.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 90 | 39 | 43.3 |
13C chemical shifts | 86 | 1 | 1.2 |
15N chemical shifts | 4 | 4 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MHHHHHHAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGE || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......HA.PTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGE -------110-------120-------130-------140-------150-------160-------170-------180-------- LLPLAVRMGAIASMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETALE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||| LLPLAVRMGAIASMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVC..QAGEGETALE
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MHHHHHHAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGE || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......HA.PTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGE -------110-------120-------130-------140-------150-------160-------170-------180-------- LLPLAVRMGAIASMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETALE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||| LLPLAVRMGAIASMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVC..QAGEGETALE
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MHHHHHHAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGE |||||||||||||||||||||||||||||||||| |||||| ||||||||| ||||||||||| |||||||||||||||||||||||| ......HAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVP.GVKEFF..PLSSIAIHQ..EFTQFRFSKKM.....GMVLEEGCPEGTVCSVLIKRDSGE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-------180-------- LLPLAVRMGAIASMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETALE ||||||||||||||||||||||||||||| |||||| |||||||||| |||||||||||||||| LLPLAVRMGAIASMRIQGRLVHGQSGMLL..........GTIPGD.....VHKRGNDWVV.GVHAAATKSGNTVVCA -------110-------120-------130-------140-------150-------160-------170-------