ATR13 Chemical Shifts
SFGLGKAQDP LDKFFSKIIF SGKPIETSYS AKGIHEKIIE AHDLHVSKSK NAPIQYASVM EYLKKTYPGP DIERIVSTLE RHDEVGAKDL GAKLRDALDR QSFGLGKAQD PLDKFFSKII FSGKPIETSY SAKGIHEKII EAHDLHVSKS KNAPIQYASV MEYLKKTYPG PDIERIVSTL ERHDEVGAKD LGAKLRDALD RQ
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 38.4 % (916 of 2388) | 36.3 % (454 of 1252) | 39.6 % (371 of 936) | 45.5 % (91 of 200) |
Backbone | 44.5 % (531 of 1192) | 45.3 % (185 of 408) | 43.1 % (255 of 592) | 47.4 % (91 of 192) |
Sidechain | 33.5 % (464 of 1384) | 31.9 % (269 of 844) | 36.7 % (195 of 532) | 0.0 % (0 of 8) |
Aromatic | 13.1 % (23 of 176) | 13.6 % (12 of 88) | 12.5 % (11 of 88) | |
Methyl | 47.2 % (100 of 212) | 45.3 % (48 of 106) | 49.1 % (52 of 106) |
1. ATR13
SFGLGKAQDP LDKFFSKIIF SGKPIETSYS AKGIHEKIIE AHDLHVSKSK NAPIQYASVM EYLKKTYPGP DIERIVSTLE RHDEVGAKDL GAKLRDALDR QSFGLGKAQD PLDKFFSKII FSGKPIETSY SAKGIHEKII EAHDLHVSKS KNAPIQYASV MEYLKKTYPG PDIERIVSTL ERHDEVGAKD LGAKLRDALD RQSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ATR13 | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 150 (±5.0) mM | |
4 | D2O | [U-99% 2H] | 10 (±0.5) % | |
5 | H2O | natural abundance | 90 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | ATR13 | [U-98% 15N] | 1 (±0.1) mM | |
7 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
8 | sodium chloride | natural abundance | 150 (±5.0) mM | |
9 | D2O | [U-99% 2H] | 10 (±1.0) % | |
10 | H2O | natural abundance | 90 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | ATR13 | [U-10% 13C; U-99% 15N] | 1 (±0.1) mM | |
12 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
13 | sodium chloride | natural abundance | 150 (±5.0) mM | |
14 | D2O | [U-99% 2H] | 10 (±1.0) % | |
15 | H2O | natural abundance | 90 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | ATR13 | [U-98% 15N] | 1 (±0.1) mM | |
17 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
18 | sodium chloride | natural abundance | 150 (±5.0) mM | |
19 | D2O | [U-99% 2H] | 10 (±1.0) % | |
20 | Pf1 phage | natural abundance | 12 (±1.0) mg/mL | |
21 | H2O | natural abundance | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | ATR13 | [U-98% 15N] | 1 (±0.1) mM | |
7 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
8 | sodium chloride | natural abundance | 150 (±5.0) mM | |
9 | D2O | [U-99% 2H] | 10 (±1.0) % | |
10 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ATR13 | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 150 (±5.0) mM | |
4 | D2O | [U-99% 2H] | 10 (±0.5) % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ATR13 | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 150 (±5.0) mM | |
4 | D2O | [U-99% 2H] | 10 (±0.5) % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ATR13 | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 150 (±5.0) mM | |
4 | D2O | [U-99% 2H] | 10 (±0.5) % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ATR13 | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 150 (±5.0) mM | |
4 | D2O | [U-99% 2H] | 10 (±0.5) % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | ATR13 | [U-98% 15N] | 1 (±0.1) mM | |
7 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
8 | sodium chloride | natural abundance | 150 (±5.0) mM | |
9 | D2O | [U-99% 2H] | 10 (±1.0) % | |
10 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ATR13 | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 150 (±5.0) mM | |
4 | D2O | [U-99% 2H] | 10 (±0.5) % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ATR13 | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 150 (±5.0) mM | |
4 | D2O | [U-99% 2H] | 10 (±0.5) % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ATR13 | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 150 (±5.0) mM | |
4 | D2O | [U-99% 2H] | 10 (±0.5) % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ATR13 | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 150 (±5.0) mM | |
4 | D2O | [U-99% 2H] | 10 (±0.5) % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ATR13 | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 150 (±5.0) mM | |
4 | D2O | [U-99% 2H] | 10 (±0.5) % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ATR13 | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 150 (±5.0) mM | |
4 | D2O | [U-99% 2H] | 10 (±0.5) % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ATR13 | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 150 (±5.0) mM | |
4 | D2O | [U-99% 2H] | 10 (±0.5) % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance II - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ATR13 | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 150 (±5.0) mM | |
4 | D2O | [U-99% 2H] | 10 (±0.5) % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | ATR13 | [U-98% 15N] | 1 (±0.1) mM | |
7 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
8 | sodium chloride | natural abundance | 150 (±5.0) mM | |
9 | D2O | [U-99% 2H] | 10 (±1.0) % | |
10 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | ATR13 | [U-10% 13C; U-99% 15N] | 1 (±0.1) mM | |
12 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
13 | sodium chloride | natural abundance | 150 (±5.0) mM | |
14 | D2O | [U-99% 2H] | 10 (±1.0) % | |
15 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | ATR13 | [U-98% 15N] | 1 (±0.1) mM | |
17 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
18 | sodium chloride | natural abundance | 150 (±5.0) mM | |
19 | D2O | [U-99% 2H] | 10 (±1.0) % | |
20 | Pf1 phage | natural abundance | 12 (±1.0) mg/mL | |
21 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 7.1 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | ATR13 | [U-98% 15N] | 1 (±0.1) mM | |
7 | potassium phosphate | natural abundance | 20 (±1.0) mM | |
8 | sodium chloride | natural abundance | 150 (±5.0) mM | |
9 | D2O | [U-99% 2H] | 10 (±1.0) % | |
10 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_17525_2lai.nef |
Input source #2: Coordindates | 2lai.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----60--------70--------80--------90-------100-------110-------120-------130-------140-------150--- SFGLGKAQDPLDKFFSKIIFSGKPIETSYSAKGIHEKIIEAHDLHVSKSKNAPIQYASVMEYLKKTYPGPDIERIVSTLERHDEVGAKDLGAKLRDALDR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SFGLGKAQDPLDKFFSKIIFSGKPIETSYSAKGIHEKIIEAHDLHVSKSKNAPIQYASVMEYLKKTYPGPDIERIVSTLERHDEVGAKDLGAKLRDALDR --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 - Q | Q -
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 101 | 0 | 0 | 100.0 |
Content subtype: combined_17525_2lai.nef
Assigned chemical shifts
-----60--------70--------80--------90-------100-------110-------120-------130-------140-------150--- SFGLGKAQDPLDKFFSKIIFSGKPIETSYSAKGIHEKIIEAHDLHVSKSKNAPIQYASVMEYLKKTYPGPDIERIVSTLERHDEVGAKDLGAKLRDALDR ||||||| ||||||||||||| |||||||||||||| |||| || ||||| |||||||||||||||||||||||||||||||| ..GLGKAQD.LDKFFSKIIFSGK.IETSYSAKGIHEKI.EAHD.......NA..........LKKTY.GPDIERIVSTLERHDEVGAKDLGAKLRDALDR - Q | Q
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 626 | 403 | 64.4 |
13C chemical shifts | 468 | 320 | 68.4 |
15N chemical shifts | 104 | 77 | 74.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 204 | 160 | 78.4 |
13C chemical shifts | 202 | 149 | 73.8 |
15N chemical shifts | 96 | 77 | 80.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 422 | 243 | 57.6 |
13C chemical shifts | 266 | 171 | 64.3 |
15N chemical shifts | 8 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 38 | 70.4 |
13C chemical shifts | 54 | 42 | 77.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 44 | 11 | 25.0 |
13C chemical shifts | 44 | 11 | 25.0 |
Distance restraints
-----60--------70--------80--------90-------100-------110-------120-------130-------140-------150--- SFGLGKAQDPLDKFFSKIIFSGKPIETSYSAKGIHEKIIEAHDLHVSKSKNAPIQYASVMEYLKKTYPGPDIERIVSTLERHDEVGAKDLGAKLRDALDR | |||| | |||| |||||| |||||||||||||| |||| ||||| ||||||||||||||||||||||||||||||| ...L.KAQD.L.KFFS.IIFSGK.IETSYSAKGIHEKI.EAHD...................LKKTY.GPDIERIVSTLERHDEVGAKDLGAKLRDALD -----60--------70--------80--------90-------100-------110-------120-------130-------140-------150-- - Q
Dihedral angle restraints
-----60--------70--------80--------90-------100-------110-------120-------130-------140-------150--- SFGLGKAQDPLDKFFSKIIFSGKPIETSYSAKGIHEKIIEAHDLHVSKSKNAPIQYASVMEYLKKTYPGPDIERIVSTLERHDEVGAKDLGAKLRDALDR |||||| |||| |||| |||| ||| |||||||||| || ||||||||||||||| ||||||||||||| ..GLGKAQ....KFFS.IIFS...IETS.SAK.IHEKIIEAHD.....................KT....DIERIVSTLERHDEV.AKDLGAKLRDALD -----60--------70--------80--------90-------100-------110-------120-------130-------140-------150-- - Q
RDC restraints