Solution NMR structure of the AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli, Northeast Structural Genomics Consortium Target ReR242
MEKAMPESFV VRREAHLAAP PAAVFALMTD PEKILRWMGT EAEVEPEPGG LYLVNVTGAR FARGSFREVV PVHRLAYSFG WDGSEVVPPG SSLVEIDLIE QGGGTLLRLT HSGLPSAEQC AGHEEGWAHY LGRLTEVAAG RDPGPDPFYG RRLEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.2 % (1635 of 1793) | 91.8 % (850 of 926) | 90.6 % (647 of 714) | 90.2 % (138 of 153) |
Backbone | 92.9 % (868 of 934) | 93.8 % (305 of 325) | 92.6 % (428 of 462) | 91.8 % (135 of 147) |
Sidechain | 90.1 % (902 of 1001) | 90.7 % (545 of 601) | 89.8 % (354 of 394) | 50.0 % (3 of 6) |
Aromatic | 71.5 % (123 of 172) | 73.3 % (63 of 86) | 71.1 % (59 of 83) | 33.3 % (1 of 3) |
Methyl | 95.8 % (161 of 168) | 95.2 % (80 of 84) | 96.4 % (81 of 84) |
1. AHSA1-like protein RHE CH02687 (1-152) from Rhizobium etli
MEKAMPESFV VRREAHLAAP PAAVFALMTD PEKILRWMGT EAEVEPEPGG LYLVNVTGAR FARGSFREVV PVHRLAYSFG WDGSEVVPPG SSLVEIDLIE QGGGTLLRLT HSGLPSAEQC AGHEEGWAHY LGRLTEVAAG RDPGPDPFYG RRLEHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) mM | |
6 | DTT | natural abundance | 10 (±0.5) mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-5% 13C; U-100% 15N] | 0.76 (±0.07) mM | |
8 | MES | natural abundance | 20 (±1.0) mM | |
9 | sodium chloride | natural abundance | 100 (±5.0) mM | |
10 | calcium chloride | natural abundance | 5 (±0.25) mM | |
11 | DTT | natural abundance | 10 (±0.5) mM | |
12 | sodium azide | natural abundance | 0.02 (±0.001) mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
14 | MES | natural abundance | 20 (±1.0) mM | |
15 | sodium chloride | natural abundance | 100 (±5.0) mM | |
16 | calcium chloride | natural abundance | 5 (±0.25) mM | |
17 | sodium azide | natural abundance | 0.02 (±0.001) % | |
18 | DTT | natural abundance | 10 (±0.5) mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) mM | |
6 | DTT | natural abundance | 10 (±0.5) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) mM | |
6 | DTT | natural abundance | 10 (±0.5) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) mM | |
6 | DTT | natural abundance | 10 (±0.5) mM |
Bruker Avance III - 850 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
14 | MES | natural abundance | 20 (±1.0) mM | |
15 | sodium chloride | natural abundance | 100 (±5.0) mM | |
16 | calcium chloride | natural abundance | 5 (±0.25) mM | |
17 | sodium azide | natural abundance | 0.02 (±0.001) % | |
18 | DTT | natural abundance | 10 (±0.5) mM |
Bruker Avance III - 850 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
14 | MES | natural abundance | 20 (±1.0) mM | |
15 | sodium chloride | natural abundance | 100 (±5.0) mM | |
16 | calcium chloride | natural abundance | 5 (±0.25) mM | |
17 | sodium azide | natural abundance | 0.02 (±0.001) % | |
18 | DTT | natural abundance | 10 (±0.5) mM |
Bruker Avance III - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-5% 13C; U-100% 15N] | 0.76 (±0.07) mM | |
8 | MES | natural abundance | 20 (±1.0) mM | |
9 | sodium chloride | natural abundance | 100 (±5.0) mM | |
10 | calcium chloride | natural abundance | 5 (±0.25) mM | |
11 | DTT | natural abundance | 10 (±0.5) mM | |
12 | sodium azide | natural abundance | 0.02 (±0.001) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-5% 13C; U-100% 15N] | 0.76 (±0.07) mM | |
8 | MES | natural abundance | 20 (±1.0) mM | |
9 | sodium chloride | natural abundance | 100 (±5.0) mM | |
10 | calcium chloride | natural abundance | 5 (±0.25) mM | |
11 | DTT | natural abundance | 10 (±0.5) mM | |
12 | sodium azide | natural abundance | 0.02 (±0.001) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) mM | |
6 | DTT | natural abundance | 10 (±0.5) mM |
Bruker Avance III - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) mM | |
6 | DTT | natural abundance | 10 (±0.5) mM |
Bruker Avance III - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) mM | |
6 | DTT | natural abundance | 10 (±0.5) mM |
Bruker Avance III - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) mM | |
6 | DTT | natural abundance | 10 (±0.5) mM |
Bruker Avance III - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) mM | |
6 | DTT | natural abundance | 10 (±0.5) mM |
Bruker Avance III - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) mM | |
6 | DTT | natural abundance | 10 (±0.5) mM |
Bruker Avance III - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) mM | |
6 | DTT | natural abundance | 10 (±0.5) mM |
Bruker Avance III - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) mM | |
6 | DTT | natural abundance | 10 (±0.5) mM |
Bruker Avance III - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) mM | |
6 | DTT | natural abundance | 10 (±0.5) mM |
Bruker Avance III - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) mM | |
6 | DTT | natural abundance | 10 (±0.5) mM |
Bruker Avance III - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) mM | |
6 | DTT | natural abundance | 10 (±0.5) mM |
Bruker Avance III - 850 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
14 | MES | natural abundance | 20 (±1.0) mM | |
15 | sodium chloride | natural abundance | 100 (±5.0) mM | |
16 | calcium chloride | natural abundance | 5 (±0.25) mM | |
17 | sodium azide | natural abundance | 0.02 (±0.001) % | |
18 | DTT | natural abundance | 10 (±0.5) mM |
Bruker Avance III - 850 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
14 | MES | natural abundance | 20 (±1.0) mM | |
15 | sodium chloride | natural abundance | 100 (±5.0) mM | |
16 | calcium chloride | natural abundance | 5 (±0.25) mM | |
17 | sodium azide | natural abundance | 0.02 (±0.001) % | |
18 | DTT | natural abundance | 10 (±0.5) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli | [U-100% 13C; U-100% 15N] | 0.72 (±0.07) mM | |
2 | MES | natural abundance | 20 (±1.0) mM | |
3 | sodium chloride | natural abundance | 100 (±5.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) mM | |
6 | DTT | natural abundance | 10 (±0.5) mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17530_2lak.nef |
Input source #2: Coordindates | 2lak.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MEKAMPESFVVRREAHLAAPPAAVFALMTDPEKILRWMGTEAEVEPEPGGLYLVNVTGARFARGSFREVVPVHRLAYSFGWDGSEVVPPGSSLVEIDLIE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEKAMPESFVVRREAHLAAPPAAVFALMTDPEKILRWMGTEAEVEPEPGGLYLVNVTGARFARGSFREVVPVHRLAYSFGWDGSEVVPPGSSLVEIDLIE -------110-------120-------130-------140-------150-------160 QGGGTLLRLTHSGLPSAEQCAGHEEGWAHYLGRLTEVAAGRDPGPDPFYGRRLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| QGGGTLLRLTHSGLPSAEQCAGHEEGWAHYLGRLTEVAAGRDPGPDPFYGRRLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 160 | 0 | 0 | 100.0 |
Content subtype: combined_17530_2lak.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MEKAMPESFVVRREAHLAAPPAAVFALMTDPEKILRWMGTEAEVEPEPGGLYLVNVTGARFARGSFREVVPVHRLAYSFGWDGSEVVPPGSSLVEIDLIE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .EKAMPESFVVRREAHLAAPPAAVFALMTDPEKILRWMGTEAEVEPEPGGLYLVNVTGARFARGSFREVVPVHRLAYSFGWDGSEVVPPGSSLVEIDLIE -------110-------120-------130-------140-------150-------160 QGGGTLLRLTHSGLPSAEQCAGHEEGWAHYLGRLTEVAAGRDPGPDPFYGRRLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||| | || QGGGTLLRLTHSGLPSAEQCAGHEEGWAHYLGRLTEVAAGRDPGPDPFYGRR.E....HH
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
16 | HIS | ND1 | 197.9 |
16 | HIS | NE2 | 177.7 |
73 | HIS | ND1 | 203.8 |
73 | HIS | NE2 | 182.2 |
84 | SER | HG | 5.19 |
91 | SER | HG | 6.06 |
105 | THR | HG1 | 6.07 |
111 | HIS | ND1 | 200.4 |
111 | HIS | NE2 | 176.7 |
123 | HIS | ND1 | 167.0 |
123 | HIS | NE2 | 251.3 |
129 | HIS | ND1 | 209.7 |
129 | HIS | NE2 | 178.7 |
135 | THR | HG1 | 4.98 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 926 | 845 | 91.3 |
13C chemical shifts | 714 | 639 | 89.5 |
15N chemical shifts | 165 | 144 | 87.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 325 | 308 | 94.8 |
13C chemical shifts | 320 | 288 | 90.0 |
15N chemical shifts | 147 | 134 | 91.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 601 | 537 | 89.4 |
13C chemical shifts | 394 | 351 | 89.1 |
15N chemical shifts | 18 | 10 | 55.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 88 | 84 | 95.5 |
13C chemical shifts | 88 | 84 | 95.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 86 | 61 | 70.9 |
13C chemical shifts | 83 | 57 | 68.7 |
15N chemical shifts | 3 | 1 | 33.3 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MEKAMPESFVVRREAHLAAPPAAVFALMTDPEKILRWMGTEAEVEPEPGGLYLVNVTGARFARGSFREVVPVHRLAYSFGWDGSEVVPPGSSLVEIDLIE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||| .EKAMPESFVVRREAHLAAPPAAVFALMTDPEKILRWMGTEAEVEPEPGGLYLVNVTGARFAR.SFREVVPVHRLAYSFGWDGSEVVPPGSSLVEIDLIE -------110-------120-------130-------140-------150-------160 QGGGTLLRLTHSGLPSAEQCAGHEEGWAHYLGRLTEVAAGRDPGPDPFYGRRLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||| || || QGGGTLLRLTHSGLPSAEQCAGHEEGWAHYLGRLTEVAAGRDPGPDPFY.RR......HH
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MEKAMPESFVVRREAHLAAPPAAVFALMTDPEKILRWMGTEAEVEPEPGGLYLVNVTGARFARGSFREVVPVHRLAYSFGWDGSEVVPPGSSLVEIDLIE |||||||||| ||||||||| ||||||| |||| |||| ||||| |||||| ||||||||| ........FVVRREAHLA..PAAVFALMT.PEKILRW...EAEV.......YLVN...........REVVP.HRLAYS.............SLVEIDLIE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160 QGGGTLLRLTHSGLPSAEQCAGHEEGWAHYLGRLTEVAAGRDPGPDPFYGRRLEHHHHHH |||||||||| ||||||||||||||||||||||||| ...GTLLRLTHSG..SAEQCAGHEEGWAHYLGRLTEVAAG -------110-------120-------130-------140