NMR resonance assignment of the autoimmunity protein SpaI from Bacillus subtilis ATCC 6633
GSTMHFTDDN ENDTSETMES LIDKGKLDQV VYDDQLYHLK EKVDEDKKGK VIGAIGQTFF VDGDGKRWSE EELKEPYISN NPDEIREKKP LRYGKVYSTN EDSDAKDEII VEFNREYYRA VLIKNEKE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.3 % (1467 of 1523) | 96.3 % (772 of 802) | 95.9 % (561 of 585) | 98.5 % (134 of 136) |
Backbone | 97.4 % (742 of 762) | 96.6 % (252 of 261) | 97.6 % (367 of 376) | 98.4 % (123 of 125) |
Sidechain | 95.8 % (844 of 881) | 96.1 % (520 of 541) | 95.1 % (313 of 329) | 100.0 % (11 of 11) |
Aromatic | 81.0 % (94 of 116) | 82.8 % (48 of 58) | 78.9 % (45 of 57) | 100.0 % (1 of 1) |
Methyl | 98.2 % (108 of 110) | 96.4 % (53 of 55) | 100.0 % (55 of 55) |
1. SpaI
GSTMHFTDDN ENDTSETMES LIDKGKLDQV VYDDQLYHLK EKVDEDKKGK VIGAIGQTFF VDGDGKRWSE EELKEPYISN NPDEIREKKP LRYGKVYSTN EDSDAKDEII VEFNREYYRA VLIKNEKESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DSS | natural abundance | 10 uM | |
4 | SpaI | [U-15N] | 300.0 ~ 400.0 uM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DSS | natural abundance | 10 uM | |
10 | SpaI | [U-13C; U-15N; U-2H] | 420 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 50 mM | |
14 | sodium chloride | natural abundance | 100 mM | |
15 | DSS | natural abundance | 10 uM | |
16 | SpaI | [U-13C; U-15N] | 300.0 ~ 400.0 uM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Solvent system 90% D2O/10% H2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | sodium phosphate | natural abundance | 50 mM | |
20 | sodium chloride | natural abundance | 100 mM | |
21 | DSS | natural abundance | 10 uM | |
22 | SpaI | [U-13C; U-15N] | 300 uM | |
23 | H2O | natural abundance | 90 % | |
24 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DSS | natural abundance | 10 uM | |
4 | SpaI | [U-15N] | 300.0 ~ 400.0 uM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% D2O/10% H2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | sodium phosphate | natural abundance | 50 mM | |
20 | sodium chloride | natural abundance | 100 mM | |
21 | DSS | natural abundance | 10 uM | |
22 | SpaI | [U-13C; U-15N] | 300 uM | |
23 | H2O | natural abundance | 90 % | |
24 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 50 mM | |
14 | sodium chloride | natural abundance | 100 mM | |
15 | DSS | natural abundance | 10 uM | |
16 | SpaI | [U-13C; U-15N] | 300.0 ~ 400.0 uM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 50 mM | |
14 | sodium chloride | natural abundance | 100 mM | |
15 | DSS | natural abundance | 10 uM | |
16 | SpaI | [U-13C; U-15N] | 300.0 ~ 400.0 uM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DSS | natural abundance | 10 uM | |
10 | SpaI | [U-13C; U-15N; U-2H] | 420 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DSS | natural abundance | 10 uM | |
10 | SpaI | [U-13C; U-15N; U-2H] | 420 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DSS | natural abundance | 10 uM | |
10 | SpaI | [U-13C; U-15N; U-2H] | 420 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 50 mM | |
14 | sodium chloride | natural abundance | 100 mM | |
15 | DSS | natural abundance | 10 uM | |
16 | SpaI | [U-13C; U-15N] | 300.0 ~ 400.0 uM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 50 mM | |
14 | sodium chloride | natural abundance | 100 mM | |
15 | DSS | natural abundance | 10 uM | |
16 | SpaI | [U-13C; U-15N] | 300.0 ~ 400.0 uM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 50 mM | |
14 | sodium chloride | natural abundance | 100 mM | |
15 | DSS | natural abundance | 10 uM | |
16 | SpaI | [U-13C; U-15N] | 300.0 ~ 400.0 uM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% D2O/10% H2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | sodium phosphate | natural abundance | 50 mM | |
20 | sodium chloride | natural abundance | 100 mM | |
21 | DSS | natural abundance | 10 uM | |
22 | SpaI | [U-13C; U-15N] | 300 uM | |
23 | H2O | natural abundance | 90 % | |
24 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% D2O/10% H2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | sodium phosphate | natural abundance | 50 mM | |
20 | sodium chloride | natural abundance | 100 mM | |
21 | DSS | natural abundance | 10 uM | |
22 | SpaI | [U-13C; U-15N] | 300 uM | |
23 | H2O | natural abundance | 90 % | |
24 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DSS | natural abundance | 10 uM | |
4 | SpaI | [U-15N] | 300.0 ~ 400.0 uM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DSS | natural abundance | 10 uM | |
4 | SpaI | [U-15N] | 300.0 ~ 400.0 uM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 50 mM | |
14 | sodium chloride | natural abundance | 100 mM | |
15 | DSS | natural abundance | 10 uM | |
16 | SpaI | [U-13C; U-15N] | 300.0 ~ 400.0 uM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% D2O/10% H2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | sodium phosphate | natural abundance | 50 mM | |
20 | sodium chloride | natural abundance | 100 mM | |
21 | DSS | natural abundance | 10 uM | |
22 | SpaI | [U-13C; U-15N] | 300 uM | |
23 | H2O | natural abundance | 90 % | |
24 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 50 mM | |
14 | sodium chloride | natural abundance | 100 mM | |
15 | DSS | natural abundance | 10 uM | |
16 | SpaI | [U-13C; U-15N] | 300.0 ~ 400.0 uM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DSS | natural abundance | 10 uM | |
10 | SpaI | [U-13C; U-15N; U-2H] | 420 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_17534_2lvl.nef |
Input source #2: Coordindates | 2lvl.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSTMHFTDDNENDTSETMESLIDKGKLDQVVYDDQLYHLKEKVDEDKKGKVIGAIGQTFFVDGDGKRWSEEELKEPYISNNPDEIREKKPLRYGKVYSTN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSTMHFTDDNENDTSETMESLIDKGKLDQVVYDDQLYHLKEKVDEDKKGKVIGAIGQTFFVDGDGKRWSEEELKEPYISNNPDEIREKKPLRYGKVYSTN -------110-------120-------- EDSDAKDEIIVEFNREYYRAVLIKNEKE |||||||||||||||||||||||||||| EDSDAKDEIIVEFNREYYRAVLIKNEKE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 128 | 0 | 0 | 100.0 |
Content subtype: combined_17534_2lvl.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSTMHFTDDNENDTSETMESLIDKGKLDQVVYDDQLYHLKEKVDEDKKGKVIGAIGQTFFVDGDGKRWSEEELKEPYISNNPDEIREKKPLRYGKVYSTN ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .STMHFTDDNENDTSETMESLIDKGKLDQVVYDDQLYHLKEKVDEDKKGKVIGAIGQTFFVDGDGKRWSEEELKEPYISNNPDEIREKKPLRYGKVYSTN -------110-------120-------- EDSDAKDEIIVEFNREYYRAVLIKNEKE |||||||||||||||||||||||||||| EDSDAKDEIIVEFNREYYRAVLIKNEKE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 802 | 783 | 97.6 |
13C chemical shifts | 585 | 564 | 96.4 |
15N chemical shifts | 141 | 137 | 97.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 261 | 257 | 98.5 |
13C chemical shifts | 256 | 250 | 97.7 |
15N chemical shifts | 125 | 123 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 541 | 526 | 97.2 |
13C chemical shifts | 329 | 314 | 95.4 |
15N chemical shifts | 16 | 14 | 87.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 57 | 55 | 96.5 |
13C chemical shifts | 57 | 55 | 96.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 47 | 81.0 |
13C chemical shifts | 57 | 44 | 77.2 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSTMHFTDDNENDTSETMESLIDKGKLDQVVYDDQLYHLKEKVDEDKKGKVIGAIGQTFFVDGDGKRWSEEELKEPYISNNPDEIREKKPLRYGKVYSTN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..TMHFTDDNENDTSETMESLIDKGKLDQVVYDDQLYHLKEKVDEDKKGKVIGAIGQTFFVDGDGKRWSEEELKEPYISNNPDEIREKKPLRYGKVYSTN -------110-------120-------- EDSDAKDEIIVEFNREYYRAVLIKNEKE |||||||||||||||||||||||||||| EDSDAKDEIIVEFNREYYRAVLIKNEKE
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSTMHFTDDNENDTSETMESLIDKGKLDQVVYDDQLYHLKEKVDEDKKGKVIGAIGQTFFVDGDGKRWSEEELKEPYISNNPDEIREKKPLRYGKVYSTN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSTMHFTDDNENDTSETMESLIDKGKLDQVVYDDQLYHLKEKVDEDKKGKVIGAIGQTFFVDGDGKRWSEEELKEPYISNNPDEIREKKPLRYGKVYSTN -------110-------120-------- EDSDAKDEIIVEFNREYYRAVLIKNEKE |||||||||||||||||||||||||||| EDSDAKDEIIVEFNREYYRAVLIKNEKE
RDC restraints